DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and CG13506

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster


Alignment Length:329 Identity:71/329 - (21%)
Similarity:128/329 - (38%) Gaps:79/329 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GRDALLTCVVHDLVSFKVAWLRVDTQTILSIQNHVITKNHRISISHTEHRIWQ---------LKI 100
            |.|.:|.|   |..:|:             :.|.|:...:||.|::.::.|.|         :.:
  Fly    84 GDDVILNC---DARNFQ-------------LSNAVVWYKNRIIIANGQNPISQRVQCMLNNSILL 132

  Fly   101 RDVQESDRGWYMCQINTDPMKSQMGYLDVVVPPDIVDYQTSQDVVRSTGQNVTLTCSATGVPMPT 165
            |:|...|...|.|                    :|:..:..|......|..:::.|....:...:
  Fly   133 RNVSPEDSDDYYC--------------------E
ILPQRVRQHTALRVGARLSILCDDRDITDRS 177

  Fly   166 ITWRR-------------EEATPILISDDGDREVFSVEGQN--LTLWQVQRSHMGAYLCIASNGV 215
            .|:|:             :.||.....:|.:.:..||:.||  :.|..|...:.|.|.|:|.:|.
  Fly   178 QTFRQGDHHKLECRTYLPDNATIKWSFNDLNGQPSSVDNQNGVIILDNVDEKNAGDYQCLADDGS 242

  Fly   216 PPTVSKRVMLVVNFAPTIWTRYDTIYVGLGQKLTLECITESQPASVNFWLRDSQLLQ-GGSY--- 276
            .......|.:.|.::|.:.|....:....|....|.|...::|...:::::|.:.|| ...|   
  Fly   243 RHPPHGTVHIDV
QYSPIVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIKDGKTLQLSDKYSLK 307

  Fly   277 ESVSVDHVFRIVMRITL--RPITKRDFGEYICRAKNAMGQTDRIITVHHKAKKHGQHSHQTSSRE 339
            :||..||     .|.||  |.:|..|.|||:|:.:||:|.        ::.|.|..::.:|...|
  Fly   308 DSVHNDH-----NRTTLIVREVTDSDLGEYLCQVENAIGS--------NEVKVHVSYNPETPQFE 359

  Fly   340 SQFI 343
            ...:
  Fly   360 DMTV 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 18/88 (20%)
Ig 39..122 CDD:299845 18/85 (21%)
Ig 132..213 CDD:299845 19/95 (20%)
IG_like 141..227 CDD:214653 20/100 (20%)
IG_like 239..322 CDD:214653 25/88 (28%)
IGc2 245..313 CDD:197706 24/73 (33%)
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 18/97 (19%)
IGc2 83..146 CDD:197706 18/97 (19%)
IG_like 176..254 CDD:214653 17/77 (22%)
Ig 176..239 CDD:299845 14/62 (23%)
I-set 258..349 CDD:254352 28/103 (27%)
Ig 275..348 CDD:143165 25/85 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442857
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.