DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and wrapper

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster


Alignment Length:313 Identity:86/313 - (27%)
Similarity:131/313 - (41%) Gaps:56/313 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SELNNSDPKFSGP-----INNSTVPVGRDALLTCVVHDLVSFKVAWLRVDTQTILSIQNHVITKN 83
            ::|.||....|.|     ..|.||.      |.|.::....: |.|.| |...::..::..:...
  Fly    29 NDLENSQKFKSIPTTVKTYENDTVQ------LPCTLNTPFRY-VRWHR-DDVALVDSRHPELPPP 85

  Fly    84 HRISISHTEHRIW---QLKIRDVQESDRGWYMCQINTD--------PMKSQMGYLDVVVPPDIVD 137
            .||       .:|   .|::.:||.||.|.|.|::|:|        .::.|:....::.|.|:  
  Fly    86 DRI-------MLWPNGSLQVANVQSSDTGDYYCEMNSDSGHVVQQHAIEVQLAPQVLIEPSDL-- 141

  Fly   138 YQTSQDVVRSTGQNVTLTCSATGVPMPTITWRREEATPILISDDGDREVFSVEGQNLTLWQVQRS 202
              |.|.:    |....:.|.|.|||.|.||||.........|:.|:|       |:|.|....|:
  Fly   142 --TEQRI----GAIFEVVCEAQGVPQPVITWRLNGNVIQPQSNTGNR-------QSLILEIKSRN 193

  Fly   203 HMGAYLCIASNGVPPTVSKRVMLVVNFAPTIWTRYDTIYVGLGQKLTLECITESQPASVNFWLRD 267
            ..|...|:|||||.......|.|.|.|:|.:......:|..||.:..||||.|:.||:...|...
  Fly   194 QAGLIECVASNGVGEPAVANVYLHVLFSPEVSIPQPVVYTKLGSRAHLECIVEAAPAATVKWFHH 258

  Fly   268 SQLLQGGSYESV---------SVDHVFRIVMR-ITLRPITKRDFGEYICRAKN 310
            ...:..|::.:.         ||||....|.. :.::.:...|.|:|.|||.|
  Fly   259 GLPVALGAHSTTHESELQTNRSVDHYVNAVRHMLVVKSVRNADMGQYECRASN 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 23/96 (24%)
Ig 39..122 CDD:299845 22/93 (24%)
Ig 132..213 CDD:299845 25/80 (31%)
IG_like 141..227 CDD:214653 28/85 (33%)
IG_like 239..322 CDD:214653 24/82 (29%)
IGc2 245..313 CDD:197706 22/76 (29%)
wrapperNP_477404.1 Ig 41..124 CDD:299845 23/97 (24%)
IG_like 41..118 CDD:214653 23/91 (25%)
IG_like 145..218 CDD:214653 27/83 (33%)
Ig 147..219 CDD:299845 27/78 (35%)
I-set 224..323 CDD:254352 24/88 (27%)
IGc2 236..314 CDD:197706 22/76 (29%)
FN3 339..431 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.