DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and Lac

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster


Alignment Length:371 Identity:103/371 - (27%)
Similarity:155/371 - (41%) Gaps:58/371 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WLLLLQSVCFSQASFSELNNSDPKFSGPINNSTVPVGRDALLTCVVHDLVSFKVAWLRVDTQTI- 72
            |..||.::...|.    |....|..|.........:|......|.|.....:.|.:|:.|:..: 
  Fly    11 WSTLLLAIFVQQT----LAQRTPTISYITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVF 71

  Fly    73 LSIQNHVITKNHRISISHTEH-RIWQLKIRDVQESDRGWYMCQ--INTDPMKSQMGYLDVVVPPD 134
            ||..:.::.|:.|.|:.:..: ..::|:|:|:||:|.|.|.||  |:|....|....|.|..||.
  Fly    72 LSTGSTLVIKDSRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRPPV 136

  Fly   135 IVDYQTSQDVVRSTGQNVTLTCSATGVPMPTITWRREEATPILISDDGDREVFSVEGQNLTLWQV 199
            |.|..| |.||.|.|..|.:.|.|:|.|.||||||||. ..||.:|..     :..|..|.:..|
  Fly   137 ISDNST-QSVVASEGSEVQMECYASGYPTPTITWRREN-NAILPTDSA-----TYVGNTLRIKSV 194

  Fly   200 QRSHMGAYLCIASNGVPPTVSKRVMLVVNFAPTIWTRYDTIYVGLGQKLTLECITESQPASVNFW 264
            ::...|.|.|:|.|||.....:.:.:.|.|||.|......:...|...:.|||..|:.|.....|
  Fly   195 KKEDRGTYYCVADNGVSKGDRRNINVEVEFAPVITVPRPRLGQALQYDMDLECHIEAYPPPAIVW 259

  Fly   265 LRDSQLLQGGSYESVS--------VDHVFRIVMRITLRPITKRDFGEYICRAKNAMGQTDRIITV 321
            .:|...|....:.|:|        .|...|::      .:.||.:|:|:|:|.|..|:.:     
  Fly   260 TKDDIQLANNQHYSISHFATADEYTDSTLRVI------TVEKRQYGDYVCKATNRFGEAE----- 313

  Fly   322 HHKAKKHGQHSHQTSSRESQFIVI---------EEYIANMSDKSCS 358
                           :|.:.|..|         :.|||...|.|.:
  Fly   314 ---------------ARVNLFETIIPVCPPACGQAYIAGAEDVSAT 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 24/89 (27%)
Ig 39..122 CDD:299845 23/86 (27%)
Ig 132..213 CDD:299845 33/80 (41%)
IG_like 141..227 CDD:214653 31/85 (36%)
IG_like 239..322 CDD:214653 21/90 (23%)
IGc2 245..313 CDD:197706 19/75 (25%)
LacNP_523713.2 IG_like 36..131 CDD:214653 25/94 (27%)
FR1 37..50 CDD:409353 1/12 (8%)
Ig strand A' 37..42 CDD:409353 0/4 (0%)
Ig strand B 44..51 CDD:409353 0/6 (0%)
CDR1 51..59 CDD:409353 1/7 (14%)
Ig strand C 59..63 CDD:409353 1/3 (33%)
FR2 60..63 CDD:409353 1/2 (50%)
CDR2 67..81 CDD:409353 2/13 (15%)
Ig strand C' 68..72 CDD:409353 0/3 (0%)
Ig strand C' 79..81 CDD:409353 0/1 (0%)
FR3 84..115 CDD:409353 11/30 (37%)
Ig strand D 84..90 CDD:409353 2/5 (40%)
Ig strand E 94..102 CDD:409353 2/7 (29%)
Ig strand F 108..115 CDD:409353 3/6 (50%)
CDR3 116..124 CDD:409353 2/7 (29%)
FR4 124..130 CDD:409353 1/5 (20%)
Ig strand G 124..130 CDD:409353 1/5 (20%)
Ig_3 134..208 CDD:404760 33/80 (41%)
Ig strand B 153..157 CDD:409353 1/3 (33%)
Ig strand C 166..170 CDD:409353 3/3 (100%)
Ig strand E 187..191 CDD:409353 1/3 (33%)
Ig strand F 201..206 CDD:409353 2/4 (50%)
Ig strand G 215..218 CDD:409353 0/2 (0%)
Ig 227..318 CDD:416386 23/116 (20%)
Ig strand C 256..260 CDD:409353 0/3 (0%)
Ig strand E 286..290 CDD:409353 0/3 (0%)
Ig strand F 300..305 CDD:409353 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442830
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - otm40772
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
76.750

Return to query results.
Submit another query.