DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and dpr19

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster


Alignment Length:358 Identity:80/358 - (22%)
Similarity:132/358 - (36%) Gaps:75/358 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PSFW------LLLLQSVCFSQASFSELNNSDPKFSGPI-------NNSTV--PVGRDALLTCVVH 55
            |..|      .|||.|..||..  .::.:|...|...:       ||:.|  ..|..|:|.|||.
  Fly     3 PKRWHLHLSCFLLLLSSTFSDV--GKITSSQNHFGNTLQSQFNTKNNTRVIAQKGGLAILPCVVK 65

  Fly    56 DLVSFKVAWLRVDTQTILSIQNHVITKNHRISISHTEHR-IWQLKIRDVQESDRGWYMCQINTDP 119
            ......|:|:|.....:|::.....:.:.|..:.||.|. .|.|:|:.|:|.|||:|.||::..|
  Fly    66 VNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQLSIYP 130

  Fly   120 MKSQMGYLDVVVPPDIVDYQTSQDVVRSTGQNVTLTCS-ATGVPMPTITWRREEATPILISDDGD 183
            .:|.:  :::.:...:.:..::.::.......:.|.|. ......|...:...::..|.....|.
  Fly   131 TQSIV--IELKIVEAVAEISSAPELHIDETSTLRLECKLKRATENPAFVFWYHDSKMINYDSQGG 193

  Fly   184 REVFSVEGQNLTLWQVQRS-----HMGAYLCIASNGVPPTVSKRVMLVVNFAPTIWTRYDTIYVG 243
            ..|.|:...|....|..||     ........:||||..::                        
  Fly   194 FVVTSIGQSNPQSGQFYRSSPANKSRATMPMESSNGVLNSL------------------------ 234

  Fly   244 LGQKLTLECITESQPASVNFWLRDSQ---LLQGGSYESVSVDHVFRIVMRITLRPITKRDFGEYI 305
            ||....::....:.|:|..:..:..|   ||.    .||||         :|::.:..|..|.|.
  Fly   235 LGSSDAIKAPAANVPSSTPYMTQQHQSAYLLN----PSVSV---------LTVKQVNFRHAGNYT 286

  Fly   306 CRAKNAMGQTDRIITVH------HKAKKHGQHS 332
            |...||...:   ||||      ..|.:|...|
  Fly   287 CAPSNARPAS---ITVHVLRGEKTAAMQHANRS 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 29/88 (33%)
Ig 39..122 CDD:299845 28/85 (33%)
Ig 132..213 CDD:299845 11/86 (13%)
IG_like 141..227 CDD:214653 15/91 (16%)
IG_like 239..322 CDD:214653 20/85 (24%)
IGc2 245..313 CDD:197706 17/70 (24%)
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 26/76 (34%)
IGc2 55..125 CDD:197706 23/69 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.