DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and FCRL6

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_005245185.1 Gene:FCRL6 / 343413 HGNCID:31910 Length:444 Species:Homo sapiens


Alignment Length:207 Identity:45/207 - (21%)
Similarity:68/207 - (32%) Gaps:57/207 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 GQNVTLTCSATGVPMPTITWRREEATPILISDDGDREVFSVEGQNLTLWQVQRSHMGAYLCIASN 213
            |..:||.|..         |:....:.:....||....||.|.|.|::........|.|.|   :
Human    42 GDALTLRCQG---------WKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSC---S 94

  Fly   214 G----VPPT---VSKRVMLVVN--FAPTIWTRYDTIYVGLGQKLTLECITESQPASVNFWL---- 265
            |    :|.|   .|:..|:.|.  |.|.:.:...:.....|..:||.|.|:..|......|    
Human    95 GQVMYIPQTFTQTS
ETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSF 159

  Fly   266 -RDSQLLQG-GSYESVSVDHVFRIVMRITLRPITKR-DFGEYICRAKNAMGQTDR---------- 317
             :|...||. |.:..:.:             |..|. |.|.|.|......||..:          
Human   160 HKDGHTLQDRGPHPELCI-------------PGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQ 211

  Fly   318 ------IITVHH 323
                  ::|:||
Human   212 APVSRPVLTLHH 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653
Ig 39..122 CDD:299845
Ig 132..213 CDD:299845 15/63 (24%)
IG_like 141..227 CDD:214653 20/84 (24%)
IG_like 239..322 CDD:214653 20/105 (19%)
IGc2 245..313 CDD:197706 17/74 (23%)
FCRL6XP_005245185.1 Ig2_FcgammaR_like 29..108 CDD:143230 18/77 (23%)
Ig_2 122..210 CDD:290606 19/100 (19%)
IG_like 133..208 CDD:214653 19/87 (22%)
Ig_3 216..290 CDD:290638 3/8 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.