Sequence 1: | NP_001097100.1 | Gene: | DIP-iota / 33925 | FlyBaseID: | FBgn0031837 | Length: | 376 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005245185.1 | Gene: | FCRL6 / 343413 | HGNCID: | 31910 | Length: | 444 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 45/207 - (21%) |
---|---|---|---|
Similarity: | 68/207 - (32%) | Gaps: | 57/207 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 149 GQNVTLTCSATGVPMPTITWRREEATPILISDDGDREVFSVEGQNLTLWQVQRSHMGAYLCIASN 213
Fly 214 G----VPPT---VSKRVMLVVN--FAPTIWTRYDTIYVGLGQKLTLECITESQPASVNFWL---- 265
Fly 266 -RDSQLLQG-GSYESVSVDHVFRIVMRITLRPITKR-DFGEYICRAKNAMGQTDR---------- 317
Fly 318 ------IITVHH 323 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-iota | NP_001097100.1 | IG_like | 39..125 | CDD:214653 | |
Ig | 39..122 | CDD:299845 | |||
Ig | 132..213 | CDD:299845 | 15/63 (24%) | ||
IG_like | 141..227 | CDD:214653 | 20/84 (24%) | ||
IG_like | 239..322 | CDD:214653 | 20/105 (19%) | ||
IGc2 | 245..313 | CDD:197706 | 17/74 (23%) | ||
FCRL6 | XP_005245185.1 | Ig2_FcgammaR_like | 29..108 | CDD:143230 | 18/77 (23%) |
Ig_2 | 122..210 | CDD:290606 | 19/100 (19%) | ||
IG_like | 133..208 | CDD:214653 | 19/87 (22%) | ||
Ig_3 | 216..290 | CDD:290638 | 3/8 (38%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |