DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and fipi

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster


Alignment Length:256 Identity:61/256 - (23%)
Similarity:101/256 - (39%) Gaps:35/256 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 ITKNH--RISISHTEHRIWQLKI--RDVQESDRGWYMCQINTDPMKSQMGYLDVVVPPDIVDYQT 140
            |.:.|  ||.|..|...  ||||  ..:..:|:|.:.|:.....:.|:.  .|::|...|...:.
  Fly    64 IIREHKGRIHIEQTSTE--QLKIVFAHIALADKGNWSCEAADGSLHSKS--FDLIV
YQKITFTEN 124

  Fly   141 SQDVVRSTGQNVTLTCSATGVPMPTITWRREEATPILISDDGDREVFSVEGQNLTLWQVQRSHMG 205
            :..:....|:..|:.|...|.|.|.:|| .....|| .:...|...|.:....|.:.:|.::..|
  Fly   125 ATVMTVKEGEKATILCEVKGEPQPNVTW-HFNGQPI-SAGAADDSKFRILADGLLINKVTQNDTG 187

  Fly   206 AYLCIA--SNGVPPTVSKRVMLVVNFAPTIWTRYDTI---YVGLGQKLTLECITESQPASVNFWL 265
            .|.|.|  .|.:...:.:|.:|:......||::...:   |..:....||.|...::|.:...|.
  Fly   188 EYACRAYQVNSIASDMQERTVLMKIEHKPIWSKTPFVSLKYAYINGTATLMCEALAEPPANFTWY 252

  Fly   266 RDSQLL---------QGGSYESVSVDHVFRIVMRITLRPITKRDFGEYICRAKNAMGQTDR 317
            |....|         |..||.|           .:|:..:....|..|.|||:|.:|..:|
  Fly   253 RKHNKLHSNNRLYTIQSDSYWS-----------SLTIHVLNTSAFDNYRCRARNDLGTIER 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 14/48 (29%)
Ig 39..122 CDD:299845 13/45 (29%)
Ig 132..213 CDD:299845 19/82 (23%)
IG_like 141..227 CDD:214653 21/87 (24%)
IG_like 239..322 CDD:214653 21/91 (23%)
IGc2 245..313 CDD:197706 18/76 (24%)
fipiNP_787975.1 IG_like 33..115 CDD:214653 15/54 (28%)
I-set 128..202 CDD:254352 19/75 (25%)
Ig 133..>193 CDD:299845 17/61 (28%)
IG_like 228..307 CDD:214653 21/86 (24%)
Ig 235..305 CDD:143165 20/79 (25%)
FN3 312..415 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442851
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.