DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and bdl

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster


Alignment Length:334 Identity:75/334 - (22%)
Similarity:132/334 - (39%) Gaps:56/334 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLLQSVCFSQA-SFSELNNSDPKF-SGPINNSTVPVGRDALLTCVVHDLVSFK--VAWLRVDTQ 70
            :||:...|.|.| ......|.:.|. |..:.|..:....||.:..:||.....|  ..|...:|.
  Fly    23 ILLMNISCTSAARDHRRQTNLEAKVGSHVVFNCYIDFPFDAPIPYLVHWTKDNKKIFTWYEQETS 87

  Fly    71 T--ILSIQNHVITKNH----RISISHTEHRIWQLKIRDVQESDRGWYMCQI---NTDP------- 119
            |  :.:.:.|:: :||    |.|::.|.          ::|||:|||.||:   |..|       
  Fly    88 TSELFNGRLHLV-ENHPEFGRASVNLTA----------IRESDQGWYHCQVSFPNRSPSVRNNGT 141

  Fly   120 ---MKSQMGYLDVVVPPDIVDYQTSQDVVRSTGQNVTLTCSATGVPMPTITWRREEATPILISDD 181
               :..|.|.| :.:||  |: ||.::     ||.....|..........:|.::   .:|:.:.
  Fly   142 AYHLAVQGGSL-IRIPP--VN-QTIRE-----GQTAFFHCVMKHPENSQASWYKD---GVLLQEV 194

  Fly   182 GD--REVFSVEGQNLTLWQVQRSHMGAYLCIASNGVPPTVSKRVMLVVNFAPTIWTRYDTIYVGL 244
            .|  |..:.....:|::.....|.:|.|.|...|......:.:..|.:.:...:......:::..
  Fly   195 QDLVRRFYMGPDGSLSIDPTMMSDLGEYECKVRNSDGELQTAKAFLNIQYKAKVIYAPPEVFLPY 259

  Fly   245 GQKLTLECITESQPASVNF-WLRDSQLLQGGSYESVSVDHVF-RIVMRITLRPITKRDFGEYICR 307
            ||...|:|...:.|...|. |.:|..|     ::|.:|..|| ::...:....:.:...|.|.|.
  Fly   260 GQPAVLDCHFRANPPLKNLRWEKDGLL-----FDSYNVPGVFYKMNGSLFFAKVDENHAGSYTCT 319

  Fly   308 AKNAMGQTD 316
            ..|.:| ||
  Fly   320 PYNDLG-TD 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 26/106 (25%)
Ig 39..122 CDD:299845 25/103 (24%)
Ig 132..213 CDD:299845 17/82 (21%)
IG_like 141..227 CDD:214653 14/87 (16%)
IG_like 239..322 CDD:214653 20/80 (25%)
IGc2 245..313 CDD:197706 17/69 (25%)
bdlNP_608822.1 IG_like 42..128 CDD:214653 26/96 (27%)
Ig 43..131 CDD:299845 25/98 (26%)
I-set 153..242 CDD:254352 19/99 (19%)
Ig 157..242 CDD:299845 18/95 (19%)
Ig_2 252..337 CDD:290606 20/82 (24%)
IG_like 260..327 CDD:214653 18/72 (25%)
I-set 341..428 CDD:254352
IGc2 356..419 CDD:197706
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.