DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and dpr4

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster


Alignment Length:239 Identity:69/239 - (28%)
Similarity:101/239 - (42%) Gaps:25/239 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LPSFWLLLLQSVCFSQAS-----FSELNNSDPKFSGPINNS----TVPVGRDALLTCVVHDLVSF 60
            |...||||... |.....     :.|...|.|.|.   |:|    |..||:.|||.|.|.:|...
  Fly    15 LVPLWLLLFLD-CGMVGGEVPPHYWETPYSQPYFD---NSSRREVTATVGQAALLHCRVRNLGDR 75

  Fly    61 KVAWLRVDTQTILSIQNHVITKNHRISISHTE-HRIWQLKIRDVQESDRGWYMCQINTDPMKSQM 124
            .|:|:|.....||::.....|.:.|....|:| ...|.|:|...|..|.|.|.||::|:|..||.
  Fly    76 AVSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTEPKISQG 140

  Fly   125 GYLDVVVPPDIVDYQTSQDVVRSTGQNVTLTCSATGVPMPT--ITWRREEATPILISDDGDREVF 187
            ..|:|||  .......:.::...:|.::.|||.|...|:|.  |.|.:.:.. :..|..|...|.
  Fly   141 FRLNVVV--SRAKILGNAELFIKSGSDINLTCLAMQSPVPPSFIYWYKGKRV-MNYSQRGGINVI 202

  Fly   188 ---SVEGQNLTLWQVQRSHMGAYLCIASNGVPPTVSKRVMLVVN 228
               |.....|.:.:...:..|.|.|..|:....:|   |:.|:|
  Fly   203 TERSTRTSKLLIAKATPADSGNYTCSPSSSDSASV---VVHVIN 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 32/90 (36%)
Ig 39..122 CDD:299845 30/87 (34%)
Ig 132..213 CDD:299845 17/85 (20%)
IG_like 141..227 CDD:214653 20/90 (22%)
IG_like 239..322 CDD:214653
IGc2 245..313 CDD:197706
dpr4NP_001014616.2 V-set 53..146 CDD:284989 32/92 (35%)
IG_like 53..145 CDD:214653 32/91 (35%)
ig 153..227 CDD:278476 16/74 (22%)
IG_like 161..>227 CDD:214653 16/66 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.