DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and CG6867

DIOPT Version :10

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster


Alignment Length:194 Identity:66/194 - (34%)
Similarity:101/194 - (52%) Gaps:9/194 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 DVVVPPDIVDYQT---SQDVVRSTGQNVTLTCSATGVPMPTITWRREEATPILISDDGDREVFSV 189
            |:::||.|.|.|.   .:.|:...|:::.|:|:|||.|.|.:.||||:...|.::   ..|:.|:
  Fly   426 DLLIPPSITDIQVPDFQRTVIVEEGRSLNLSCTATGTPTPQVEWRREDGRTINVN---GVEMASI 487

  Fly   190 EGQNLTLWQVQRSHMGAYLCIASNGVPPTVSKRVMLVVNFAPTIWTRYDTIYVGLGQKLTLECIT 254
            .||.|....:.|..|.||.|.|:||:.|..:...::.|.|||.|......||.......||||:.
  Fly   488 SGQFLRFTNITRHQMAAYTCFANNGIAPVANATYLVEVQFAPMISVYRQMIYAEYQSSATLECLV 552

  Fly   255 ESQPASVNFWLR--DSQLLQ-GGSYESVSVDHVFRIVMRITLRPITKRDFGEYICRAKNAMGQT 315
            |:.|.::.:|.|  |.::|. ...|...|....|:..||:|:..:.|.|||.|.|.|:|.:..|
  Fly   553 EAFPEAIRYWERAYDGKILDPSDKYGIESYPEGFKTTMRLTISNLRKDDFGYYHCVARNELNAT 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653
Ig strand B 48..52 CDD:143290
Ig strand C 61..65 CDD:143290
Ig strand E 96..100 CDD:143290
Ig strand F 110..115 CDD:143290
Ig 133..227 CDD:472250 32/96 (33%)
Ig strand B 152..156 CDD:409562 1/3 (33%)
Ig strand C 165..169 CDD:409562 0/3 (0%)
Ig strand E 192..196 CDD:409562 2/3 (67%)
Ig strand F 206..211 CDD:409562 3/4 (75%)
Ig strand G 220..223 CDD:409562 0/2 (0%)
Ig_3 231..310 CDD:464046 27/81 (33%)
CG6867NP_573262.2 gly_rich_SclB <257..>409 CDD:468478
Ig 436..525 CDD:472250 29/91 (32%)
Ig strand B 453..457 CDD:409353 1/3 (33%)
Ig strand C 466..470 CDD:409353 0/3 (0%)
Ig strand E 490..494 CDD:409353 2/3 (67%)
Ig strand F 504..509 CDD:409353 3/4 (75%)
Ig strand G 518..521 CDD:409353 0/2 (0%)
Ig_3 529..611 CDD:464046 27/81 (33%)
OLF 694..939 CDD:460482
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.