DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and dpr8

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:250 Identity:69/250 - (27%)
Similarity:110/250 - (44%) Gaps:37/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LPSFWLLLLQSVCF--------SQASFSEL--NNSDPKFSGPINNSTVP------VGRDALLTCV 53
            :.:.|::.|..:|.        |:..|::.  :...|...||..::|:.      ||:...|||.
  Fly     1 MSTHWIIFLGILCLLAGCTDGASKRFFTDFLQDLPTPGTGGPTFDTTIGTNITGLVGKTVKLTCR 65

  Fly    54 VHDLVSFKVAWLRVDTQTILSIQNHVITKNHRISISHTEH-RIWQLKIRDVQESDRGWYMCQINT 117
            |.:|.:..|:|:|.....:|::..:..|.:.|....|:.| ..|.|:||..|..|.|.|.|||:|
  Fly    66 VKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRIRYAQRKDSGIYECQIST 130

  Fly   118 DPMKSQMGYLDVVVPPDIVDYQTSQDVVRSTGQNVTLTC--SATGVPMPTITW--RREEATPILI 178
            .|......||::|.|  :.|.....::..:.|..:.|||  .....|.||:.|  .||     :|
  Fly   131 TPPIGHSVYLNIVEP--VTDIIGGPELHINRGSTINLTCIVKFAPEPPPTVIWSHNRE-----II 188

  Fly   179 SDDGDREVFSVEGQNLTLWQ----VQRS---HMGAYLCIASNGVPPTVSKRVMLV 226
            :.|..|...|:..:...|..    ||::   ..|.|.|..||..|.:|  ||.:|
  Fly   189 NFDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSNANPTSV--RVHIV 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 29/92 (32%)
Ig 39..122 CDD:299845 29/89 (33%)
Ig 132..213 CDD:299845 22/91 (24%)
IG_like 141..227 CDD:214653 26/96 (27%)
IG_like 239..322 CDD:214653
IGc2 245..313 CDD:197706
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 26/79 (33%)
V-set 52..143 CDD:284989 30/90 (33%)
IG_like 153..238 CDD:214653 24/91 (26%)
ig 153..232 CDD:278476 22/83 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.