DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and dpr8

DIOPT Version :10

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_727781.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:250 Identity:69/250 - (27%)
Similarity:110/250 - (44%) Gaps:37/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LPSFWLLLLQSVCF--------SQASFSEL--NNSDPKFSGPINNSTVP------VGRDALLTCV 53
            :.:.|::.|..:|.        |:..|::.  :...|...||..::|:.      ||:...|||.
  Fly     1 MSTHWIIFLGILCLLAGCTDGASKRFFTDFLQDLPTPGTGGPTFDTTIGTNITGLVGKTVKLTCR 65

  Fly    54 VHDLVSFKVAWLRVDTQTILSIQNHVITKNHRISISHTEH-RIWQLKIRDVQESDRGWYMCQINT 117
            |.:|.:..|:|:|.....:|::..:..|.:.|....|:.| ..|.|:||..|..|.|.|.|||:|
  Fly    66 VKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRIRYAQRKDSGIYECQIST 130

  Fly   118 DPMKSQMGYLDVVVPPDIVDYQTSQDVVRSTGQNVTLTC--SATGVPMPTITW--RREEATPILI 178
            .|......||::|.|  :.|.....::..:.|..:.|||  .....|.||:.|  .||     :|
  Fly   131 TPPIGHSVYLNIVEP--VTDIIGGPELHINRGSTINLTCIVKFAPEPPPTVIWSHNRE-----II 188

  Fly   179 SDDGDREVFSVEGQNLTLWQ----VQRS---HMGAYLCIASNGVPPTVSKRVMLV 226
            :.|..|...|:..:...|..    ||::   ..|.|.|..||..|.:|  ||.:|
  Fly   189 NFDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSNANPTSV--RVHIV 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 29/92 (32%)
Ig strand B 48..52 CDD:143290 1/3 (33%)
Ig strand C 61..65 CDD:143290 1/3 (33%)
Ig strand E 96..100 CDD:143290 2/3 (67%)
Ig strand F 110..115 CDD:143290 2/4 (50%)
Ig 133..227 CDD:472250 27/104 (26%)
Ig strand B 152..156 CDD:409562 1/3 (33%)
Ig strand C 165..169 CDD:409562 2/5 (40%)
Ig strand E 192..196 CDD:409562 0/3 (0%)
Ig strand F 206..211 CDD:409562 2/4 (50%)
Ig strand G 220..223 CDD:409562 0/2 (0%)
Ig_3 231..310 CDD:464046
dpr8NP_727781.1 IG_like 51..131 CDD:214653 26/79 (33%)
Ig strand B 60..64 CDD:409353 1/3 (33%)
Ig strand C 73..77 CDD:409353 1/3 (33%)
Ig strand E 109..113 CDD:409353 2/3 (67%)
Ig strand F 123..128 CDD:409353 2/4 (50%)
Ig_3 153..230 CDD:464046 20/81 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.