DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and Negr1

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_036019026.1 Gene:Negr1 / 320840 MGIID:2444846 Length:362 Species:Mus musculus


Alignment Length:369 Identity:106/369 - (28%)
Similarity:160/369 - (43%) Gaps:52/369 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QSVCFSQASFSELNNSDPKFSGPINNSTVPVGRDALLTCVVHDLVSFKVAWLRVDTQTILSIQNH 78
            |||.|..|:              ::|..|..|..|:|.|.:.|..| |.|||  :..:|:.....
Mouse    30 QSVDFPWAA--------------VDNMLVRKGDTAVLRCYLEDGAS-KGAWL--NRSSIIFAGGD 77

  Fly    79 VITKNHRISISHTEHRIWQLKIRDVQESDRGWYMCQINTD--PMKSQMGYLDVVVPPDIVDYQTS 141
            ..:.:.|:|||....|.:.|:|::|..:|.|.|.|.:.|.  |...|: :|.|.|||.|  |..|
Mouse    78 KWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQV-HLTVQVPPKI--YDIS 139

  Fly   142 QDVVRSTGQNVTLTCSATGVPMPTITWRR--EEATPILISDDGDREVFSVEGQNLTLWQVQRSHM 204
            .|:..:.|.||||||.|||.|.|.|:||.  ..|.|.            ..||.|.::.:.|...
Mouse   140 NDMTINEGTNVTLTCLATGKPEPVISWRHISPSAKPF------------ENGQYLDIYGITRDQA 192

  Fly   205 GAYLCIASNGVPPTVSKRVMLVVNFAPTIWTRYDTIYVGL---GQKLTLECITESQPASVNFWLR 266
            |.|.|.|.|.|.....|:|.::|||||||    ..|..|.   |:...:.|.....|.....|.:
Mouse   193 GEYECSAENDVSFPDVKKVRVIVNFAPTI----QEIKSGTVTPGRSGLIRCEGAGVPPPAFEWYK 253

  Fly   267 DSQLLQGGSYESVSVDHVFRIVMRITLRPITKRDFGEYICRAKNAMGQTDRIITVHHKAKKHGQH 331
            ..:.|..|....:..:...|.::.:|  .:|:..||.|.|.|.|.:|.|:..:.: ::..:....
Mouse   254 GEKRLFNGQQGIIIQNFSTRSILTVT--NVTQEHFGNYTCVAANKLGTTNASLPL-NQIIEPTTS 315

  Fly   332 SHQTSSRESQFIVIEEYIANMSDKSCSFQPLWIMFLCFVNKVSL 375
            |..||...|    ..:|  .::..:|.....|.:.|...:.:|:
Mouse   316 SPVTSPAPS----TAQY--GITGSACDLFSCWSLALTLSSVISI 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 28/87 (32%)
Ig 39..122 CDD:299845 27/84 (32%)
Ig 132..213 CDD:299845 31/82 (38%)
IG_like 141..227 CDD:214653 31/87 (36%)
IG_like 239..322 CDD:214653 19/85 (22%)
IGc2 245..313 CDD:197706 15/67 (22%)
Negr1XP_036019026.1 FR1 38..55 CDD:409353 5/30 (17%)
Ig strand A' 40..46 CDD:409353 2/5 (40%)
IG_like 41..129 CDD:214653 29/91 (32%)
Ig strand B 48..56 CDD:409353 3/7 (43%)
CDR1 56..60 CDD:409353 1/3 (33%)
FR2 61..68 CDD:409353 5/9 (56%)
Ig strand C 61..67 CDD:409353 5/8 (63%)
CDR2 69..79 CDD:409353 1/9 (11%)
Ig strand C' 71..74 CDD:409353 1/2 (50%)
Ig strand C' 76..79 CDD:409353 0/2 (0%)
FR3 80..115 CDD:409353 12/34 (35%)
Ig strand D 84..91 CDD:409353 4/6 (67%)
Ig strand E 94..100 CDD:409353 1/5 (20%)
Ig strand F 107..115 CDD:409353 3/7 (43%)
CDR3 116..120 CDD:409353 1/3 (33%)
Ig strand G 120..129 CDD:409353 3/9 (33%)
FR4 122..129 CDD:409353 2/7 (29%)
Ig strand A' 139..144 CDD:409353 2/4 (50%)
IGc2 146..204 CDD:197706 26/69 (38%)
Ig strand B 150..157 CDD:409353 5/6 (83%)
Ig strand C 163..168 CDD:409353 2/4 (50%)
Ig strand C' 170..172 CDD:409353 0/1 (0%)
Ig strand E 180..186 CDD:409353 2/5 (40%)
Ig strand F 193..200 CDD:409353 3/6 (50%)
Ig_3 219..295 CDD:404760 19/81 (23%)
putative Ig strand A 219..225 CDD:409353 3/9 (33%)
Ig strand B 235..239 CDD:409353 0/3 (0%)
Ig strand C 248..252 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 0/3 (0%)
Ig strand F 288..293 CDD:409353 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833615
Domainoid 1 1.000 45 1.000 Domainoid score I12107
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4449
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8732
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.790

Return to query results.
Submit another query.