DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and Nrg

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001245581.1 Gene:Nrg / 31792 FlyBaseID:FBgn0264975 Length:1309 Species:Drosophila melanogaster


Alignment Length:297 Identity:73/297 - (24%)
Similarity:119/297 - (40%) Gaps:69/297 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 QTILSIQNHVITKNHRISISHTEHRIWQLKIRDVQESDRGWYMCQINTDPMKSQMGYLDVVVPPD 134
            ||:.|.....|..:.||:..|...   .|.||.....|.|.|.|.::.....:|.  ..:::..:
  Fly   277 QTVWSKDGQRIQWSDRITQGHYGK---SLVIRQTNFDDAGTYTCDVSNGVGNAQS--FSII
LNVN 336

  Fly   135 IVDYQTSQDVVRSTGQN--VTLTCSATGVPMPTITWRR-----EEATP---ILISDDGDREVFSV 189
            .|.|.|.:..:.:..::  |...|.|.|||.|.|:|..     |::||   ..::|:..|.:..|
  Fly   337 SVPYFTKEPEIATAAEDEEVVFECRAAGVPEPKISWIHNGKPIEQSTPNPRRTVTDNTIRIINLV 401

  Fly   190 EGQNLTLWQVQRSHMGAYLCIASNGV--------------PPTVSKRVMLVVNFAPTIWTRYDTI 240
            :|..           |.|.|.|:|.:              |||:|:        ||...:..|  
  Fly   402 KGDT-----------GNYGCNATNSLGYVYKDVYLNVQAEPPTISE--------APAAVSTVD-- 445

  Fly   241 YVGLGQKLTLECITESQPASVNFWLRDSQLLQGGSYE-SVSVDHVFRIVMRITLRPITKRDFGEY 304
                |:.:|::|.....|..:..|||.|..|.||.|. ..:.|        :.::.:|..|.|:|
  Fly   446 ----GRNVTIKCRVNGSPKPLVKWLRASNWLTGGRYNVQANGD--------LEIQDVTFSDAGKY 498

  Fly   305 ICRAKNAMG--QTDRIITVHHKAKKHGQHSHQTSSRE 339
            .|.|:|..|  |.|..:.|    |:|.:.:.:..:.|
  Fly   499 TCYAQNKFGEIQADGSLVV----KEHTRITQEPQNYE 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 15/54 (28%)
Ig 39..122 CDD:299845 14/51 (27%)
Ig 132..213 CDD:299845 23/90 (26%)
IG_like 141..227 CDD:214653 25/109 (23%)
IG_like 239..322 CDD:214653 23/85 (27%)
IGc2 245..313 CDD:197706 20/68 (29%)
NrgNP_001245581.1 Ig 55..128 CDD:299845
IG_like 57..127 CDD:214653
Ig 135..214 CDD:299845
IG_like 141..216 CDD:214653
ig 251..332 CDD:278476 15/59 (25%)
I-set 339..427 CDD:254352 23/98 (23%)
Ig 354..427 CDD:299845 21/83 (25%)
I-set 432..517 CDD:254352 29/106 (27%)
Ig 446..517 CDD:299845 23/78 (29%)
I-set 522..611 CDD:254352 1/10 (10%)
ig 525..609 CDD:278476 1/7 (14%)
FN3 613..707 CDD:238020
FN3 716..807 CDD:238020
fn3 817..905 CDD:278470
FN3 917..1004 CDD:238020
FN3 1041..1111 CDD:238020
Bravo_FIGEY 1155..>1221 CDD:290593
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.