DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and dpr14

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster


Alignment Length:211 Identity:60/211 - (28%)
Similarity:97/211 - (45%) Gaps:20/211 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PKFSGPIN--NSTVPVGRDALLTCVVHDLVSFKVAWL--RVDTQTILSIQNHVITKNHRISISHT 91
            |.|:.|..  |.:..:.....|.|.|:||....|:|:  |.|..|:::...|..:.:.|.|:...
  Fly    73 PFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFE 137

  Fly    92 EHRIWQLKIRDVQESDRGWYMCQINTDPMKSQMGYLDVVVP-PDIVDYQTS--QDVVRSTGQNVT 153
            |...|:|.|:...|.|.|.|.||:::.|....:.||.::|| .:|:|.:.|  .:.....|..:.
  Fly   138 EPNDWKLLIQFANERDEGPYECQVSSHPPLVLLVYLTIIVPHVEILDERGSATPEKYYKAGSTIE 202

  Fly   154 LTCSATGVPMPT--ITWRREEATPILISDDGDREVFSVE-----GQNLT---LWQVQRSHMGAYL 208
            |.|..:.:|.|:  ||||.   .|.|::.|..|...||:     |:.|:   :....|...|.|.
  Fly   203 LQCVISKIPHPSSYITWRH---GPRLLNYDTSRGGISVKTDMLPGRALSRLYIANANRQDTGNYT 264

  Fly   209 CIASNGVPPTVSKRVM 224
            |:..|.:..||...|:
  Fly   265 CMLGNEITETVVVHVL 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 25/87 (29%)
Ig 39..122 CDD:299845 25/84 (30%)
Ig 132..213 CDD:299845 25/93 (27%)
IG_like 141..227 CDD:214653 26/96 (27%)
IG_like 239..322 CDD:214653
IGc2 245..313 CDD:197706
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 24/79 (30%)
Ig 84..169 CDD:299845 24/84 (29%)
IG_like 191..279 CDD:214653 24/90 (27%)
Ig 201..274 CDD:143165 21/75 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.