DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and DIP-alpha

DIOPT Version :10

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster


Alignment Length:378 Identity:140/378 - (37%)
Similarity:208/378 - (55%) Gaps:43/378 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLLQSVCFSQASFSELNNSDPKFSGPINNSTVPVGRDALLTCVVHDLVSFKVAWLRVDTQTILS 74
            |||:.|:..:..:|      .|:|...|:|.:|.|||||..||.|..|..::|.||:.||:.|.:
  Fly    27 LLLIVSLLEAIGAF------QPEFVESISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQA 85

  Fly    75 IQNHVITKNHRISISHTEHRIWQLKIRDVQESDRGWYMCQINTDPMKSQMGYLDVVVPPDIVDYQ 139
            |..:|||.|.|:::||.:...|.|.|:.|.|.|||.||||:||||||||:|:||||:|||.:...
  Fly    86 IHENVITHNPRVTVSHLDQNTWNLHIKAVSEEDRGGYMCQLNTDPMKSQIGFLDVVIPPDFISED 150

  Fly   140 TSQDVVRSTGQNVTLTCSATGVPMPTITWRREEATPILISDDGDREVF--SVEGQNLTLWQVQRS 202
            ||.||:...|.:|.|||.|.|.|.|.:|||||:...|::.|:...:..  |..|:.|.|.::.|:
  Fly   151 TSSDVIVPEGSSVRLTCRARGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGEVLKLSKISRN 215

  Fly   203 HMGAYLCIASNGVPPTVSKRVMLVVNFAPTIWTRYDTIYVGLGQKLTLECITESQPASVNFWLRD 267
            .||:|||||||||||:||||:.|.::|.|.|......:...||..:.:||..|:.|.|:|:|::|
  Fly   216 EMGSYLCIASNGVPPSVSKRISLSIHFHPVIQVPNQLVGAPLGTDVQIECHVEASPKSINYWIKD 280

  Fly   268 S--QLLQGGSYE-SVSVDHVFRIVMRITLRPITKRDFGEYICRAKNAMGQTDRIITVHH------ 323
            :  .::..|.|. ..|...::...|.:.:|...|.|.|.|.|.|||::|:.|..|.::.      
  Fly   281 TGEMIVTSGKYHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSLGEVDSSIRLYEIPGPNR 345

  Fly   324 --------------------------KAKKHGQHSHQTSSRESQFIVIEEYIA 350
                                      |.|:..:.::|....|.|:..:|::.|
  Fly   346 NKNPLNGGGKGGGAGGSLDADANDILKQKQQVKVTYQPEDEELQYGSVEDFEA 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 45/85 (53%)
Ig strand B 48..52 CDD:143290 1/3 (33%)
Ig strand C 61..65 CDD:143290 1/3 (33%)
Ig strand E 96..100 CDD:143290 2/3 (67%)
Ig strand F 110..115 CDD:143290 3/4 (75%)
Ig 133..227 CDD:472250 45/95 (47%)
Ig strand B 152..156 CDD:409562 2/3 (67%)
Ig strand C 165..169 CDD:409562 1/3 (33%)
Ig strand E 192..196 CDD:409562 1/3 (33%)
Ig strand F 206..211 CDD:409562 3/4 (75%)
Ig strand G 220..223 CDD:409562 2/2 (100%)
Ig_3 231..310 CDD:464046 23/81 (28%)
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653 38/79 (48%)
Ig strand B 59..63 CDD:409353 1/3 (33%)
Ig strand C 72..76 CDD:409353 1/3 (33%)
Ig strand E 103..111 CDD:409353 2/7 (29%)
Ig 152..240 CDD:472250 42/87 (48%)
Ig strand B 163..167 CDD:409275 2/3 (67%)
Ig strand C 176..180 CDD:409275 1/3 (33%)
Ig strand E 205..209 CDD:409275 1/3 (33%)
Ig strand F 219..224 CDD:409275 3/4 (75%)
Ig strand G 233..236 CDD:409275 2/2 (100%)
Ig 244..337 CDD:472250 28/92 (30%)
Ig strand B 261..265 CDD:409353 0/3 (0%)
Ig strand C 274..278 CDD:409353 1/3 (33%)
Ig strand E 305..309 CDD:409353 1/3 (33%)
Ig strand F 319..324 CDD:409353 2/4 (50%)
Ig strand G 332..335 CDD:409353 1/2 (50%)

Return to query results.
Submit another query.