DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and Fcgr3a

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_997486.2 Gene:Fcgr3a / 304966 RGDID:1303067 Length:249 Species:Rattus norvegicus


Alignment Length:220 Identity:45/220 - (20%)
Similarity:76/220 - (34%) Gaps:54/220 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WLLLLQSVCFSQASFSELNNSDPKFSGPINNSTVPVGRDALLTCVVHDLVSFKVAWLRV--DTQT 71
            |.|||.:......|           ||        ||.......|:.|     ..|:||  :...
  Rat     2 WYLLLPTALLLTVS-----------SG--------VGAGLQKAVVILD-----PEWVRVLEEDCV 42

  Fly    72 ILSIQNHVITKNHRISISHTE----HRIWQLKIRDVQESDRGWYMCQIN----TDPMKSQMGYLD 128
            ||..|.....:::.....|.:    |:.....|:..:..|.|.|.||..    :||::     ||
  Rat    43 ILRCQGTFSPEDNSTKWFHNKSLISHQDANYVIQSARVKDSGMYRCQTAFSALSDPVQ-----LD 102

  Fly   129 VVVPPDIVDYQTSQDVVRSTGQNVTLTCSATGVPMPTITWRREEATPILISDDGDREVFSVEGQN 193
              |..|.:..||::.:.:. |..:.|.|.         :||......:....:|..:.:......
  Rat   103 --VHADWLLLQTTKRLFQE-GDPIRLRCH---------SWRNTPVFKVTYLQNGKGKKYFHRNSE 155

  Fly   194 LTLWQVQRSHMGAYLC---IASNGV 215
            |::.:...:..|:|.|   |..|.:
  Rat   156 LSISKATHADSGSYFCRGIIGRNNI 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 20/95 (21%)
Ig 39..122 CDD:299845 20/92 (22%)
Ig 132..213 CDD:299845 14/83 (17%)
IG_like 141..227 CDD:214653 12/78 (15%)
IG_like 239..322 CDD:214653
IGc2 245..313 CDD:197706
Fcgr3aNP_997486.2 Ig1_FcgammaR_like 25..103 CDD:409410 20/89 (22%)
Ig strand B 42..46 CDD:409410 2/3 (67%)
Ig strand C 56..60 CDD:409410 0/3 (0%)
Ig strand E 71..75 CDD:409410 0/3 (0%)
Ig strand F 85..90 CDD:409410 2/4 (50%)
Ig strand G 96..99 CDD:409410 1/2 (50%)
Ig2_FcgammaR_like 107..189 CDD:409411 14/84 (17%)
Ig strand B 123..127 CDD:409411 1/3 (33%)
Ig strand C 137..141 CDD:409411 0/3 (0%)
Ig strand E 154..158 CDD:409411 1/3 (33%)
Ig strand F 168..173 CDD:409411 2/4 (50%)
Ig strand G 182..185 CDD:409411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.