DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and Fcrla

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_038946723.1 Gene:Fcrla / 304965 RGDID:1306176 Length:350 Species:Rattus norvegicus


Alignment Length:172 Identity:38/172 - (22%)
Similarity:59/172 - (34%) Gaps:33/172 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 GQNVTLTCSA-TGVPMPTITWRREEATPILISDDGDREVFSVEGQNLTLWQVQRSHMGAYLCIA- 211
            |..:.|.|.| ...|:..:.:.||.:.   :...|.:..||:.       ..::|..|.|.|.. 
  Rat    99 GDTLVLHCRAWQDWPLTQVIFYREGSA---LGPPGSKSEFSIA-------VARKSDSGHYHCSGI 153

  Fly   212 ----SNGVPPTVSKRVMLVVN-FAPTIWTRYDTIYVGLGQKLTLECITESQPASVNFWLRDSQLL 271
                ..|...|.|...:.|.. ||..:.....:.....|..:||.|.|:     ::.....|:||
  Rat   154 FRSPGPGSQETASPVAITV
QELFAAPVLKALPSSGPQEGGSVTLSCETK-----LSLQRSASRLL 213

  Fly   272 -----QGGSYESVSVDHVFRIVMRITLRPITKRDFGEYICRA 308
                 .|.|..|..:...|||      ...::...|.|.|.|
  Rat   214 FSFYKDGRSLSSRGISSEFRI------PEASEEHSGSYWCEA 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653
Ig 39..122 CDD:299845
Ig 132..213 CDD:299845 14/69 (20%)
IG_like 141..227 CDD:214653 17/83 (20%)
IG_like 239..322 CDD:214653 18/75 (24%)
IGc2 245..313 CDD:197706 18/69 (26%)
FcrlaXP_038946723.1 Ig 86..172 CDD:416386 17/82 (21%)
Ig strand A 86..90 CDD:409353
Ig strand A' 95..97 CDD:409353
Ig strand B 101..108 CDD:409353 2/6 (33%)
Ig strand C 115..121 CDD:409353 0/5 (0%)
Ig strand C' 124..129 CDD:409353 0/7 (0%)
Ig strand E 133..137 CDD:409353 1/3 (33%)
Ig strand F 147..152 CDD:409353 2/4 (50%)
Ig strand G 162..172 CDD:409353 2/9 (22%)
IG 190..258 CDD:214652 18/71 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.