DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and Fcgr2b

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_006250295.1 Gene:Fcgr2b / 289211 RGDID:631331 Length:342 Species:Rattus norvegicus


Alignment Length:182 Identity:47/182 - (25%)
Similarity:79/182 - (43%) Gaps:29/182 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LVSFKVAWLRV---DTQTILSIQNHVITKNHRISISHTEHRIWQLKIRD----VQESDRGWYMCQ 114
            :|..:..|::|   ||.|::....| .|||......|....||.....:    ...:|.|.|.|:
  Rat    49 VVKLEPPWIQVLKEDTVTLMCEGTH-NTKNCSTQWFHNGSSIWHQAQANYTFKATVNDSGEYRCR 112

  Fly   115 IN----TDPMKSQMGYLDVVVPPDIVDYQTSQDVVRSTGQNVTLTCSATGVPMPTITWRREEATP 175
            :.    ::|:     :|.|:  .|.:..|||| :|...|:.:||.|.         :|:.::.|.
  Rat   113 MEETGISEPI-----HLGV
I--SDWLLLQTSQ-LVFEEGETITLRCH---------SWKNKQLTK 160

  Fly   176 ILISDDGDREVFSVEGQNLTLWQVQRSHMGAYLCIASNGVPPTVSKRVMLVV 227
            :|:..:|....:..:..|.::.:...||.|.|.|.|..|....|||.|.:.|
  Rat   161 VLLFQNGKPVRYYHQSSNFSIPKANHSHSGNYYCKAYLGRTMHVSKPVTITV 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 18/78 (23%)
Ig 39..122 CDD:299845 18/75 (24%)
Ig 132..213 CDD:299845 21/80 (26%)
IG_like 141..227 CDD:214653 23/85 (27%)
IG_like 239..322 CDD:214653
IGc2 245..313 CDD:197706
Fcgr2bXP_006250295.1 Ig 48..126 CDD:299845 19/82 (23%)
IG_like 54..112 CDD:214653 15/58 (26%)
Ig2_FcgammaR_like 130..212 CDD:143230 25/91 (27%)
IG_like 136..212 CDD:214653 23/85 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.