| Sequence 1: | NP_001097100.1 | Gene: | DIP-iota / 33925 | FlyBaseID: | FBgn0031837 | Length: | 376 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001274153.1 | Gene: | Lrit3 / 242235 | MGIID: | 2685267 | Length: | 681 | Species: | Mus musculus |
| Alignment Length: | 385 | Identity: | 69/385 - (17%) |
|---|---|---|---|
| Similarity: | 115/385 - (29%) | Gaps: | 177/385 - (45%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 3 RRLPS---FWLLLLQSVCFSQASFSELNNS---------DPKFSGPI------------------ 37
Fly 38 ---NNSTVPVGRDAL-----LTCVVHDLVSFKVAWLRVDTQTILSIQNHVITKNHRISISHTEHR 94
Fly 95 IWQLKIRDVQESDRGWYM-CQIN---------------TDPMK------------SQMGYLDVVV 131
Fly 132 PPDIVDYQTSQDVVRSTGQNVTLTCSATGVPMPTITWRREEATPILISDDGDREVFSVEGQNLTL 196
Fly 197 WQVQRSHMGAYLCIASNGVPPTVSKRVMLVVNFAPTIWTRYDTIYVGLGQKLTLECITESQPASV 261
Fly 262 NFWLRDSQLLQGGSYESVSVDHVFRIVMRITLRPITKRDFGEYICRAKNAMGQTDRIITV 321 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| DIP-iota | NP_001097100.1 | IG_like | 39..125 | CDD:214653 | 26/118 (22%) |
| Ig | 39..122 | CDD:299845 | 25/115 (22%) | ||
| Ig | 132..213 | CDD:299845 | 15/80 (19%) | ||
| IG_like | 141..227 | CDD:214653 | 14/85 (16%) | ||
| IG_like | 239..322 | CDD:214653 | 16/83 (19%) | ||
| IGc2 | 245..313 | CDD:197706 | 13/67 (19%) | ||
| Lrit3 | NP_001274153.1 | LRR 1. /evidence=ECO:0000255 | 56..79 | 4/8 (50%) | |
| LRR_8 | 61..117 | CDD:290566 | 10/46 (22%) | ||
| LRR 2. /evidence=ECO:0000255 | 80..103 | 5/22 (23%) | |||
| leucine-rich repeat | 83..106 | CDD:275378 | 4/22 (18%) | ||
| LRR 3. /evidence=ECO:0000255 | 104..128 | 1/23 (4%) | |||
| LRR_8 | 105..165 | CDD:290566 | 11/61 (18%) | ||
| LRR_4 | 106..146 | CDD:289563 | 4/39 (10%) | ||
| leucine-rich repeat | 107..130 | CDD:275378 | 1/22 (5%) | ||
| LRR_4 | 129..170 | CDD:289563 | 11/42 (26%) | ||
| LRR 4. /evidence=ECO:0000255 | 129..151 | 4/21 (19%) | |||
| leucine-rich repeat | 131..154 | CDD:275378 | 4/22 (18%) | ||
| LRR 5. /evidence=ECO:0000255 | 152..175 | 9/27 (33%) | |||
| leucine-rich repeat | 155..168 | CDD:275378 | 6/14 (43%) | ||
| Ig | 254..335 | CDD:299845 | 28/179 (16%) | ||
| IG_like | 263..339 | CDD:214653 | 28/172 (16%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 350..391 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 425..464 | ||||
| FN3 | 489..563 | CDD:238020 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||