DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and LILRA4

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_036408.4 Gene:LILRA4 / 23547 HGNCID:15503 Length:499 Species:Homo sapiens


Alignment Length:302 Identity:66/302 - (21%)
Similarity:112/302 - (37%) Gaps:85/302 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 TILSIQNHVITKNHRIS--------------ISHTEHRI-WQLK--------------IRDVQES 106
            |:.::.:.|:|....::              |...:||: |.|.              :..:..|
Human   124 TLSALPSPVVTSGVNVTLRCASRLGLGRFTLIEEGDHRLSWTLNSHQHNHGKFQALFPMGPLTFS 188

  Fly   107 DRGWYMC---QINT--------DPMKSQMGYLDVVVPPDIVDYQTSQDVVRSTGQNVTLTC-SAT 159
            :||.:.|   :.||        ||:  |:....|...|.::   |.|..|.:.|:|:||.| |..
Human   189 NRGTFRCYGYENNTPYVWSEPSDPL--QLLV
SGVSRKPSLL---TLQGPVVTPGENLTLQCGSDV 248

  Fly   160 GVPMPTITWRREEATPILISDDGDREVFSVEGQNLTLWQVQRSHMGAYLCIASNGV-----PPT- 218
            |....|:   .:|....|....|.:....:...|.||..|.||:.|.|.|..::.|     .|: 
Human   249 GYIRYTL---YKEGADGLPQRPGRQPQAGLSQANFTLSPVSRSYGGQYRCYGAHNVSSEWSAPSD 310

  Fly   219 ---------VSKRVMLVVNFAPTIWTRYDTIYVGLGQKLTLECITESQPASVNFWLRDSQLLQGG 274
                     :|.|..|.|...||:.:         |:|:||.|  :|......|.|..    :|.
Human   311 PLDILI
AGQISDRPSLSVQPGPTVTS---------GEKVTLLC--QSWDPMFTFLLTK----EGA 360

  Fly   275 SYESVSVDHVF---RIVMRITLRPITKRDFGEYIC---RAKN 310
            ::..:.:..::   :......:.|:|....|.|.|   |:.|
Human   361 AHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSRSSN 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 17/93 (18%)
Ig 39..122 CDD:299845 16/90 (18%)
Ig 132..213 CDD:299845 24/81 (30%)
IG_like 141..227 CDD:214653 27/101 (27%)
IG_like 239..322 CDD:214653 16/78 (21%)
IGc2 245..313 CDD:197706 16/72 (22%)
LILRA4NP_036408.4 Ig 28..118 CDD:299845
Ig 122..217 CDD:299845 17/94 (18%)
Ig 223..316 CDD:299845 26/98 (27%)
IG_like 233..>295 CDD:214653 20/64 (31%)
Ig 323..417 CDD:299845 21/95 (22%)
IG_like 333..>395 CDD:214653 14/76 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.