DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and FCGR3A

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001121064.2 Gene:FCGR3A / 2214 HGNCID:3619 Length:358 Species:Homo sapiens


Alignment Length:300 Identity:60/300 - (20%)
Similarity:97/300 - (32%) Gaps:92/300 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VPVG-RDALLTCVVH-----------------------DL----VSFKVAWLRV---DTQTILSI 75
            ||:| |.:|:||.:.                       ||    |..:..|.||   |:.| |..
Human    88 VPLGLRISLVTCPLQCGIMWQLLLPTALLLLVSAGMRTDLPKAVVFLEPQWYRVLEKDSVT-LKC 151

  Fly    76 QNHVITKNHRISISHTEHRIWQLK----IRDVQESDRGWYMCQIN----TDPMKSQ--MGYLDVV 130
            |.....:::.....|.|..|....    |......|.|.|.||.|    :||::.:  :|:|.:.
Human   152 QGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQ 216

  Fly   131 VPPDIVDYQTSQDVVRSTGQNVTLTCSATGVPMPTITWRREEATPILISDDGDREVFSVEGQNLT 195
            .|..:.   ..:|.:.       |.|.         :|:......:....:|....:.....:..
Human   217 APRWVF---KEEDPIH-------LRCH---------SWKNTALHKVTYLQNGKGRKYFHHNSDFY 262

  Fly   196 LWQVQRSHMGAYLCIASNGVPPTVSKRVMLVVNFAPTIWTRYDTIYVGLGQKLTLECITESQPA- 259
            :.:......|:|.|....|     ||.|            ..:|:.:.:.|.|.:..|:...|. 
Human   263 IPKATLKDSGSYFCRGLFG-----SKNV------------SSETVNITITQGLAVSTISSFFPPG 310

  Fly   260 -SVNFWLRDSQL--LQGGSYESVSV----------DHVFR 286
             .|:|.|....|  :..|.|.||..          ||.|:
Human   311 YQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDWKDHKFK 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 29/123 (24%)
Ig 39..122 CDD:299845 29/118 (25%)
Ig 132..213 CDD:299845 9/80 (11%)
IG_like 141..227 CDD:214653 12/85 (14%)
IG_like 239..322 CDD:214653 16/61 (26%)
IGc2 245..313 CDD:197706 15/55 (27%)
FCGR3ANP_001121064.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.