DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and FCGR2B

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_024309811.1 Gene:FCGR2B / 2213 HGNCID:3618 Length:324 Species:Homo sapiens


Alignment Length:208 Identity:42/208 - (20%)
Similarity:75/208 - (36%) Gaps:49/208 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DPKFSGPINNSTVPVGRDALLTC-VVHDLVSFKVAWLRVDTQTILSIQNHVITKNHRISISHTEH 93
            :|::...:...:|      .||| ..|...|..:.|..                |..:..:||:.
Human    55 EPQWINVLQEDSV------TLTCRGTHSPESDSIQWFH----------------NGNLIPTHTQP 97

  Fly    94 RIWQLKIRDVQESDRGWYMCQIN----TDPMKSQMGYLDVVVPPDIVDYQTSQDVVRSTGQNVTL 154
            . ::.|   ...:|.|.|.||..    :||:...:....:|:....:::|        .|:.:.|
Human    98 S-YRFK---ANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQ--------EGETIVL 150

  Fly   155 TCSATGVPMPTITWRREEATPILISDDGDREVFSVEGQNLTLWQVQRSHMGAYLCIASNGVPPTV 219
            .|.         :|:.:....:....:|..:.||....|.::.|...||.|.|.|..:.|.....
Human   151 RCH---------SWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYS 206

  Fly   220 SKRVMLVVNFAPT 232
            ||.|.:.|. ||:
Human   207 SKPVTITVQ-APS 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 18/90 (20%)
Ig 39..122 CDD:299845 18/87 (21%)
Ig 132..213 CDD:299845 15/80 (19%)
IG_like 141..227 CDD:214653 18/85 (21%)
IG_like 239..322 CDD:214653
IGc2 245..313 CDD:197706
FCGR2BXP_024309811.1 Ig1_FcgammaR_like 50..128 CDD:143229 19/98 (19%)
Ig2_FcgammaR_like 132..214 CDD:319307 20/98 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.