DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and FCER1A

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001374209.1 Gene:FCER1A / 2205 HGNCID:3609 Length:257 Species:Homo sapiens


Alignment Length:240 Identity:55/240 - (22%)
Similarity:86/240 - (35%) Gaps:66/240 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 DALLTCVVHDLVSFKVAWLRVDTQTILSIQNHVITKN-------------HRISISHTEHRIWQL 98
            |.:|.......||....|.|     |...:|..:|.|             |..|:|  |.....|
Human    21 DGVLAVPQKPKVSLNPPWNR-----IFKGENVTLTCNGNNFFEVSSTKWFHNGSLS--EETNSSL 78

  Fly    99 KIRDVQESDRGWYMC---QINTDPMKSQMGYLDVVVPPDIVDYQTSQDVVRSTGQNVTLTCSATG 160
            .|.:.:..|.|.|.|   |:|    :|:..||:|.  .|.:..|.|.:||.. ||.:.|.|..  
Human    79 NIVNAKFEDSGEYKCQHQQVN----ESEPVYLEVF--SDWLLLQASAEVVME-GQPLFLRCHG-- 134

  Fly   161 VPMPTITWRREEATPILISDDGDREVFSVEGQNLTLWQVQRSHMGAYLCIA--------SNGVPP 217
                   ||..:...::...||:...:..|..|:::........|.|.|..        |..:..
Human   135 -------WRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNI 192

  Fly   218 TVSKR------------VMLVVNFAPTIWTRYDT-IYVGLGQKLT 249
            ||.|.            :::|:.||      .|| :::...|::|
Human   193 TVIKAPREKYWLQFFIPLLVVILFA------VDTGLFISTQQQVT 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 23/93 (25%)
Ig 39..122 CDD:299845 22/90 (24%)
Ig 132..213 CDD:299845 18/88 (20%)
IG_like 141..227 CDD:214653 20/105 (19%)
IG_like 239..322 CDD:214653 3/12 (25%)
IGc2 245..313 CDD:197706 2/5 (40%)
FCER1ANP_001374209.1 Ig1_FcgammaR_like 30..108 CDD:409410 23/88 (26%)
Ig strand B 47..51 CDD:409410 0/3 (0%)
Ig strand C 61..65 CDD:409410 0/3 (0%)
Ig strand E 76..80 CDD:409410 1/3 (33%)
Ig strand F 90..95 CDD:409410 2/4 (50%)
Ig strand G 101..104 CDD:409410 1/2 (50%)
Ig2_FcgammaR_like 112..194 CDD:409411 18/91 (20%)
Ig strand B 128..132 CDD:409411 1/3 (33%)
Ig strand C 142..146 CDD:409411 0/3 (0%)
Ig strand E 159..163 CDD:409411 1/3 (33%)
Ig strand F 173..178 CDD:409411 2/4 (50%)
Ig strand G 187..190 CDD:409411 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.