Sequence 1: | NP_001097100.1 | Gene: | DIP-iota / 33925 | FlyBaseID: | FBgn0031837 | Length: | 376 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001374209.1 | Gene: | FCER1A / 2205 | HGNCID: | 3609 | Length: | 257 | Species: | Homo sapiens |
Alignment Length: | 240 | Identity: | 55/240 - (22%) |
---|---|---|---|
Similarity: | 86/240 - (35%) | Gaps: | 66/240 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 47 DALLTCVVHDLVSFKVAWLRVDTQTILSIQNHVITKN-------------HRISISHTEHRIWQL 98
Fly 99 KIRDVQESDRGWYMC---QINTDPMKSQMGYLDVVVPPDIVDYQTSQDVVRSTGQNVTLTCSATG 160
Fly 161 VPMPTITWRREEATPILISDDGDREVFSVEGQNLTLWQVQRSHMGAYLCIA--------SNGVPP 217
Fly 218 TVSKR------------VMLVVNFAPTIWTRYDT-IYVGLGQKLT 249 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-iota | NP_001097100.1 | IG_like | 39..125 | CDD:214653 | 23/93 (25%) |
Ig | 39..122 | CDD:299845 | 22/90 (24%) | ||
Ig | 132..213 | CDD:299845 | 18/88 (20%) | ||
IG_like | 141..227 | CDD:214653 | 20/105 (19%) | ||
IG_like | 239..322 | CDD:214653 | 3/12 (25%) | ||
IGc2 | 245..313 | CDD:197706 | 2/5 (40%) | ||
FCER1A | NP_001374209.1 | Ig1_FcgammaR_like | 30..108 | CDD:409410 | 23/88 (26%) |
Ig strand B | 47..51 | CDD:409410 | 0/3 (0%) | ||
Ig strand C | 61..65 | CDD:409410 | 0/3 (0%) | ||
Ig strand E | 76..80 | CDD:409410 | 1/3 (33%) | ||
Ig strand F | 90..95 | CDD:409410 | 2/4 (50%) | ||
Ig strand G | 101..104 | CDD:409410 | 1/2 (50%) | ||
Ig2_FcgammaR_like | 112..194 | CDD:409411 | 18/91 (20%) | ||
Ig strand B | 128..132 | CDD:409411 | 1/3 (33%) | ||
Ig strand C | 142..146 | CDD:409411 | 0/3 (0%) | ||
Ig strand E | 159..163 | CDD:409411 | 1/3 (33%) | ||
Ig strand F | 173..178 | CDD:409411 | 2/4 (50%) | ||
Ig strand G | 187..190 | CDD:409411 | 1/2 (50%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |