DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and Cntn3

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_032805.2 Gene:Cntn3 / 18488 MGIID:99534 Length:1028 Species:Mus musculus


Alignment Length:521 Identity:96/521 - (18%)
Similarity:157/521 - (30%) Gaps:208/521 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 CFSQASFSELNNSDPKFS-GPINN------STVPV--GRDALLTC-------------VVHDLVS 59
            ||:..|...:.:.:.|.. ..:.|      |||.|  |:..:|.|             |.::..|
Mouse   100 CFATNSLGTIVSREAKLQFAYLENFKTRMRSTVSVREGQGVVLLCGPPPHSGELSYAWVFNEYPS 164

  Fly    60 FKVAWLRVDTQTILSIQNHVITKNHRISISHTEHRIWQLKIRDVQESDRGWYMCQINTDPMKSQM 124
            |    :..|::..:|              ..|.|    |.|..|:.||.|.|.|.:.:....:::
Mouse   165 F----VEEDSRRFVS--------------QETGH----LYIAKVEPSDVGNYTCVVTSTVTNTRV 207

  Fly   125 ------------GYLDVVVPPDIVDYQTSQDVVRSTGQNVTLTCSATGVPMPTITWRREEATP-- 175
                        |.:....|.  ::.|..:.:..:.|..|.|.|.|.|.|:|.|.|||.:..|  
Mouse   208 LGSPTPLVLRSDGVMGEYEPK--IEVQFPETLPAAKGSTVRLECFALGNPVPQINWRRSDGMPFP 270

  Fly   176 ----------------------------------------------------------ILISD-- 180
                                                                      |.:.|  
Mouse   271 NKIKLRKFNGMLEIQNFQQEDTGSYECIAENSRGKNVARGRLTYYAKPYWLQLLRDVEIAVEDSL 335

  Fly   181 ------------------DGD----REVFSVEGQNLTLWQVQRSHMGAYLCIASNGVPPTVSKRV 223
                              :||    .|...:|...||:..:..:..|.:.|||.|......|...
Mouse   336 YWECRASGKPKPSYRWLKNGDALVLEERIQIENGALTITNLNVTDSGMFQCIAENKHGLIYSSAE 400

  Fly   224 MLVVNFAPTIWTR---YDTIYVGLGQKLTLECITESQPASVNFWLRDSQLLQGGSYESVSVDHVF 285
            :.||..||. ::|   ...:.|.:|..:.|:|...:.|.:::||.:...:::..:..|...|...
Mouse   401 LKVVASAPD-FSRNPMKKMVQVQVGSLVILDCKPRASPRALSFWKKGDMMVREQARVSFLNDGGL 464

  Fly   286 RIVMRITLRPITKRDFGEYICRAKN----AMGQTDRIIT-------------------------V 321
            :|:      .:||.|.|.|.|.|:|    |.|.|..::|                         |
Mouse   465 KIM------NVTKADAGTYTCTAENQFGKANGTTHLVVTEPTRIILAPSNMDVAVGESVILPCQV 523

  Fly   322 HHKA-----------------KKHGQHSHQTSSRESQFIVIEEYIANMSDKSCSFQPLWIMFLCF 369
            .|..                 ||.|.|..:.....|..::|.......|.|          ::|.
Mouse   524 QHDPLLDIMFAWYFNGALTDFKKDGSHFEKVGGSSSGDLMIRNIQLKHSGK----------YVCM 578

  Fly   370 V 370
            |
Mouse   579 V 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 23/118 (19%)
Ig 39..122 CDD:299845 23/103 (22%)
Ig 132..213 CDD:299845 27/164 (16%)
IG_like 141..227 CDD:214653 27/169 (16%)
IG_like 239..322 CDD:214653 22/111 (20%)
IGc2 245..313 CDD:197706 18/71 (25%)
Cntn3NP_032805.2 Ig 25..120 CDD:416386 4/19 (21%)
Ig strand A 27..31 CDD:409353
Ig strand A' 34..39 CDD:409353
Ig strand B 45..53 CDD:409353
Ig strand C 58..64 CDD:409353
Ig strand C' 66..69 CDD:409353
Ig strand D 76..80 CDD:409353
Ig strand E 82..88 CDD:409353
Ig strand F 95..104 CDD:409353 2/3 (67%)
Ig strand G 107..120 CDD:409353 1/12 (8%)
Ig 129..214 CDD:416386 22/106 (21%)
Ig strand A 130..135 CDD:409353 3/4 (75%)
Ig strand B 139..145 CDD:409353 1/5 (20%)
Ig strand C 153..159 CDD:409353 0/5 (0%)
Ig strand C' 164..166 CDD:409353 2/5 (40%)
Ig strand D 171..176 CDD:409353 1/18 (6%)
Ig strand E 179..183 CDD:409353 2/7 (29%)
Ig strand F 193..201 CDD:409353 2/7 (29%)
Ig strand G 203..214 CDD:409353 0/10 (0%)
Ig 227..315 CDD:416386 15/89 (17%)
Ig strand A 227..232 CDD:409353 1/6 (17%)
Ig strand A' 235..240 CDD:409353 0/4 (0%)
Ig strand B 243..252 CDD:409353 3/8 (38%)
Ig strand C 258..262 CDD:409353 1/3 (33%)
Ig strand C' 265..267 CDD:409353 0/1 (0%)
Ig strand D 276..279 CDD:409353 0/2 (0%)
Ig strand E 280..285 CDD:409353 0/4 (0%)
Ig strand F 293..301 CDD:409353 0/7 (0%)
Ig strand G 304..315 CDD:409353 0/10 (0%)
Ig 320..403 CDD:416386 14/82 (17%)
Ig strand A' 326..330 CDD:409353 0/3 (0%)
Ig strand B 334..342 CDD:409353 0/7 (0%)
Ig strand C 348..353 CDD:409353 0/4 (0%)
Ig strand C' 355..358 CDD:409353 2/2 (100%)
Ig strand D 363..367 CDD:409353 0/3 (0%)
Ig strand E 369..374 CDD:409353 2/4 (50%)
Ig strand F 383..390 CDD:409353 3/6 (50%)
Ig strand G 394..403 CDD:409353 1/8 (13%)
Ig 408..496 CDD:416386 23/94 (24%)
Ig strand A 408..413 CDD:409353 1/5 (20%)
Ig strand A' 416..421 CDD:409353 0/4 (0%)
Ig strand B 425..432 CDD:409353 1/6 (17%)
Ig strand C 440..444 CDD:409353 1/3 (33%)
Ig strand D 458..461 CDD:409353 0/2 (0%)
Ig strand E 462..467 CDD:409353 0/4 (0%)
Ig strand F 475..483 CDD:409353 4/7 (57%)
Ig strand G 489..496 CDD:409353 2/6 (33%)
Ig 498..598 CDD:416386 12/92 (13%)
Ig strand A 498..504 CDD:409353 0/5 (0%)
Ig strand A' 507..512 CDD:409353 0/4 (0%)
Ig strand B 515..523 CDD:409353 0/7 (0%)
Ig strand C 532..536 CDD:409353 0/3 (0%)
Ig strand E 560..564 CDD:409353 0/3 (0%)
Ig strand F 573..580 CDD:409353 3/17 (18%)
Ig strand G 587..591 CDD:409353
FN3 598..695 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 684..714
FN3 703..795 CDD:238020
FN3 805..898 CDD:238020
FN3 906..991 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.