Sequence 1: | NP_001097100.1 | Gene: | DIP-iota / 33925 | FlyBaseID: | FBgn0031837 | Length: | 376 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_032805.2 | Gene: | Cntn3 / 18488 | MGIID: | 99534 | Length: | 1028 | Species: | Mus musculus |
Alignment Length: | 521 | Identity: | 96/521 - (18%) |
---|---|---|---|
Similarity: | 157/521 - (30%) | Gaps: | 208/521 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 CFSQASFSELNNSDPKFS-GPINN------STVPV--GRDALLTC-------------VVHDLVS 59
Fly 60 FKVAWLRVDTQTILSIQNHVITKNHRISISHTEHRIWQLKIRDVQESDRGWYMCQINTDPMKSQM 124
Fly 125 ------------GYLDVVVPPDIVDYQTSQDVVRSTGQNVTLTCSATGVPMPTITWRREEATP-- 175
Fly 176 ----------------------------------------------------------ILISD-- 180
Fly 181 ------------------DGD----REVFSVEGQNLTLWQVQRSHMGAYLCIASNGVPPTVSKRV 223
Fly 224 MLVVNFAPTIWTR---YDTIYVGLGQKLTLECITESQPASVNFWLRDSQLLQGGSYESVSVDHVF 285
Fly 286 RIVMRITLRPITKRDFGEYICRAKN----AMGQTDRIIT-------------------------V 321
Fly 322 HHKA-----------------KKHGQHSHQTSSRESQFIVIEEYIANMSDKSCSFQPLWIMFLCF 369
Fly 370 V 370 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-iota | NP_001097100.1 | IG_like | 39..125 | CDD:214653 | 23/118 (19%) |
Ig | 39..122 | CDD:299845 | 23/103 (22%) | ||
Ig | 132..213 | CDD:299845 | 27/164 (16%) | ||
IG_like | 141..227 | CDD:214653 | 27/169 (16%) | ||
IG_like | 239..322 | CDD:214653 | 22/111 (20%) | ||
IGc2 | 245..313 | CDD:197706 | 18/71 (25%) | ||
Cntn3 | NP_032805.2 | Ig | 25..120 | CDD:416386 | 4/19 (21%) |
Ig strand A | 27..31 | CDD:409353 | |||
Ig strand A' | 34..39 | CDD:409353 | |||
Ig strand B | 45..53 | CDD:409353 | |||
Ig strand C | 58..64 | CDD:409353 | |||
Ig strand C' | 66..69 | CDD:409353 | |||
Ig strand D | 76..80 | CDD:409353 | |||
Ig strand E | 82..88 | CDD:409353 | |||
Ig strand F | 95..104 | CDD:409353 | 2/3 (67%) | ||
Ig strand G | 107..120 | CDD:409353 | 1/12 (8%) | ||
Ig | 129..214 | CDD:416386 | 22/106 (21%) | ||
Ig strand A | 130..135 | CDD:409353 | 3/4 (75%) | ||
Ig strand B | 139..145 | CDD:409353 | 1/5 (20%) | ||
Ig strand C | 153..159 | CDD:409353 | 0/5 (0%) | ||
Ig strand C' | 164..166 | CDD:409353 | 2/5 (40%) | ||
Ig strand D | 171..176 | CDD:409353 | 1/18 (6%) | ||
Ig strand E | 179..183 | CDD:409353 | 2/7 (29%) | ||
Ig strand F | 193..201 | CDD:409353 | 2/7 (29%) | ||
Ig strand G | 203..214 | CDD:409353 | 0/10 (0%) | ||
Ig | 227..315 | CDD:416386 | 15/89 (17%) | ||
Ig strand A | 227..232 | CDD:409353 | 1/6 (17%) | ||
Ig strand A' | 235..240 | CDD:409353 | 0/4 (0%) | ||
Ig strand B | 243..252 | CDD:409353 | 3/8 (38%) | ||
Ig strand C | 258..262 | CDD:409353 | 1/3 (33%) | ||
Ig strand C' | 265..267 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 276..279 | CDD:409353 | 0/2 (0%) | ||
Ig strand E | 280..285 | CDD:409353 | 0/4 (0%) | ||
Ig strand F | 293..301 | CDD:409353 | 0/7 (0%) | ||
Ig strand G | 304..315 | CDD:409353 | 0/10 (0%) | ||
Ig | 320..403 | CDD:416386 | 14/82 (17%) | ||
Ig strand A' | 326..330 | CDD:409353 | 0/3 (0%) | ||
Ig strand B | 334..342 | CDD:409353 | 0/7 (0%) | ||
Ig strand C | 348..353 | CDD:409353 | 0/4 (0%) | ||
Ig strand C' | 355..358 | CDD:409353 | 2/2 (100%) | ||
Ig strand D | 363..367 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 369..374 | CDD:409353 | 2/4 (50%) | ||
Ig strand F | 383..390 | CDD:409353 | 3/6 (50%) | ||
Ig strand G | 394..403 | CDD:409353 | 1/8 (13%) | ||
Ig | 408..496 | CDD:416386 | 23/94 (24%) | ||
Ig strand A | 408..413 | CDD:409353 | 1/5 (20%) | ||
Ig strand A' | 416..421 | CDD:409353 | 0/4 (0%) | ||
Ig strand B | 425..432 | CDD:409353 | 1/6 (17%) | ||
Ig strand C | 440..444 | CDD:409353 | 1/3 (33%) | ||
Ig strand D | 458..461 | CDD:409353 | 0/2 (0%) | ||
Ig strand E | 462..467 | CDD:409353 | 0/4 (0%) | ||
Ig strand F | 475..483 | CDD:409353 | 4/7 (57%) | ||
Ig strand G | 489..496 | CDD:409353 | 2/6 (33%) | ||
Ig | 498..598 | CDD:416386 | 12/92 (13%) | ||
Ig strand A | 498..504 | CDD:409353 | 0/5 (0%) | ||
Ig strand A' | 507..512 | CDD:409353 | 0/4 (0%) | ||
Ig strand B | 515..523 | CDD:409353 | 0/7 (0%) | ||
Ig strand C | 532..536 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 560..564 | CDD:409353 | 0/3 (0%) | ||
Ig strand F | 573..580 | CDD:409353 | 3/17 (18%) | ||
Ig strand G | 587..591 | CDD:409353 | |||
FN3 | 598..695 | CDD:238020 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 684..714 | ||||
FN3 | 703..795 | CDD:238020 | |||
FN3 | 805..898 | CDD:238020 | |||
FN3 | 906..991 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |