DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and DSCAM

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001380.2 Gene:DSCAM / 1826 HGNCID:3039 Length:2012 Species:Homo sapiens


Alignment Length:401 Identity:90/401 - (22%)
Similarity:141/401 - (35%) Gaps:124/401 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SELNNSDPKFSGPINNSTVPVGRDALLTCVVHDLVSFKVAWLRVDTQTILSIQNHVITKNHR-IS 87
            :.:|...|....|:.|.|...|||..:.|.|.....:.:.|.:         .::::..||| ::
Human   497 ARINVRGPASIRPMKNITAIAGRDTYIHCRVIGYPYYSIKWYK---------NSNLLPFNHRQVA 552

  Fly    88 ISHTEHRIWQLKIRDVQ-ESDRGWYMCQINTDPM--KSQMGYLDVVVPP---------------- 133
            ..:.    ..||:.||| |.|.|.|.|.:...|.  .||..::.|.|||                
Human   553 FENN----GTLKLSDVQKEVDEGEYTCNVLVQPQLSTSQSVHVTVKVPPFIQPFEFPRFSIGQRV 613

  Fly   134 --------------------------------DIVDYQT-------------------------- 140
                                            |.:|:.:                          
Human   614 FIPCVVVSGDLPITITWQKDGRPIPGSLGVTIDNIDFTSSLRISNLSLMHNGNYTCIARNEAAAV 678

  Fly   141 ---SQDVVRST--------------GQNVTLTCSATGVPMPTITWRREEAT------PILISDDG 182
               ||.:||..              |:.|.|.|||.|.|:|||.|:..:..      ||.:  :|
Human   679 EHQSQLIVRVPPKFVVQPRDQDGIYGKAVILNCSAEGYPVPTIVWKFSKGAGVPQFQPIAL--NG 741

  Fly   183 DREVFSVEGQNLTLWQVQRSHMGAYLCIASNGVPPTVSKRVMLVVNFAPTIWTRY-DTIYVGLGQ 246
            ..:|.|  ..:|.:..|.....|.|||..||.|...|||.:.|.|.. |.:.|.| :|.....||
Human   742 RIQVLS--NGSLLIKHVVEEDSGYYLCKVSNDVGADVSKSMYLTVKI-PAMITSYPNTTLATQGQ 803

  Fly   247 KLTLECITESQPASVNFWLRDSQLL--QGGSYESVSVDHV-FRIVMRITLRPITKRDFGEYICRA 308
            |..:.|....:...:..|.::.:::  :...| .||...| ..::..:.:.|..:.|.|.:.|.|
Human   804 KKEMSCTAHGEKPIIVRWEKEDRIINPEMARY-LVSTKEVGEEVISTLQILPTVREDSGFFSCHA 867

  Fly   309 KNAMGQTDRII 319
            .|:.|:...||
Human   868 INSYGEDRGII 878

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 24/89 (27%)
Ig 39..122 CDD:299845 22/86 (26%)
Ig 132..213 CDD:299845 31/177 (18%)
IG_like 141..227 CDD:214653 34/105 (32%)
IG_like 239..322 CDD:214653 19/84 (23%)
IGc2 245..313 CDD:197706 15/70 (21%)
DSCAMNP_001380.2 Ig 45..113 CDD:319273
I-set 235..310 CDD:254352
I-set 315..385 CDD:333254
Ig_3 407..488 CDD:316449
IGc2 518..575 CDD:197706 18/69 (26%)
I-set 596..686 CDD:333254 6/89 (7%)
Ig_DSCAM 707..784 CDD:143211 29/80 (36%)
Ig 802..889 CDD:325142 18/78 (23%)
FN3 885..978 CDD:238020
FN3 986..1083 CDD:238020
FN3 1091..1184 CDD:238020
FN3 1189..1278 CDD:238020
Ig 1303..1369 CDD:319273
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
Required for netrin-mediated axon repulsion of neuronal growth cones. /evidence=ECO:0000250|UniProtKB:Q9ERC8 1617..2012
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1718..1810
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1855..1883
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1971..2012
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.