DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and zig-4

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_509335.1 Gene:zig-4 / 181051 WormBaseID:WBGene00006981 Length:253 Species:Caenorhabditis elegans


Alignment Length:248 Identity:52/248 - (20%)
Similarity:87/248 - (35%) Gaps:55/248 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PMKSQMGYLDVVVPPDI-VDYQTSQDVVRST----------GQNVTLTCSATGVPMPTITWRREE 172
            ||.::|....|.:..:| .:|.||...::..          |:...|.|.....|..||.|:...
 Worm    19 PMHAEMHSAVVTLANEIDTNYLTSPAKIKIVAPLESALIPGGETYQLRCDIMSTPAATIHWKFNG 83

  Fly   173 ATPILISDDGDREV-------------FSVEGQNLTLWQVQRSHMGAYLCIASNGVPPTVSKRVM 224
            .   ||....:..|             ..:....||:......:.|.|.|:..|| ..|:.....
 Worm    84 K---LIQGSNELNVEEKLLNFGKAIVDTGIVASILTIQCPSAENSGTYSCVGYNG-HQTIETVAE 144

  Fly   225 LVV-----------NFAPTI--WTRYDTIYVGLGQKLTLECITESQPASVNFWLRDSQLLQGGSY 276
            :.:           ..||.|  ||  |:.:...|...||.|....|...|  |:.:.:|::.   
 Worm   145 VEIEGEASGCRSNHKSAPEIVFWT--DSRFEMTGNVATLVCRANQQVDWV--WMSNDELVKN--- 202

  Fly   277 ESVSVDHVFRIVMR--ITLRPITKRDFGEYICRAKNAMGQTDRIITVHHKAKK 327
                 :..|.::..  :.::.|...|.|.|.|.|:|..|:..:...::..|||
 Worm   203 -----NDKFTVLSNGDLVIKNIVWDDMGTYTCIARNQFGEARQETFLYPTAKK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 2/5 (40%)
Ig 39..122 CDD:299845 2/2 (100%)
Ig 132..213 CDD:299845 19/104 (18%)
IG_like 141..227 CDD:214653 19/108 (18%)
IG_like 239..322 CDD:214653 17/84 (20%)
IGc2 245..313 CDD:197706 16/69 (23%)
zig-4NP_509335.1 I-set 47..147 CDD:254352 18/103 (17%)
Ig 65..144 CDD:143165 17/82 (21%)
IG_like 176..245 CDD:214653 17/78 (22%)
Ig <193..238 CDD:299845 11/52 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.