DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and rig-5

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001251131.1 Gene:rig-5 / 172791 WormBaseID:WBGene00004372 Length:482 Species:Caenorhabditis elegans


Alignment Length:355 Identity:120/355 - (33%)
Similarity:168/355 - (47%) Gaps:61/355 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLLQSVCFSQASFSELNNSDPKFSGPINNSTVP-VGRDALLTCVVHDLVSFKVAWLRVDT-QTI 72
            ||:.:..|        ...:.|....|..:|.|. :|:|...||:|:||.|..||:::.|: ..:
 Worm    71 LLVFKQAC--------SRGAPPTIQQPSMSSAVALLGQDVDFTCIVNDLGSHMVAFVKADSPPRL 127

  Fly    73 LSIQNHVITKNH------RISISHTEHRIWQLKIRDVQESDRGWYMCQINTDPMKSQMGYLDVVV 131
            ||....|..:.:      ||...|.|   |.|.|::|||||||.|.|||||:|:....|.|||.|
 Worm   128 LSFDEKVFRRRNKYELKPRIGDLHNE---WVLTIKNVQESDRGNYSCQINTEPITLSTGELDVKV 189

  Fly   132 PPDIVDYQTSQDVVRSTGQNVTLTCSATGVPMPTITWRREEATPILISDDGDREVFSVEGQN--- 193
            || :|...|...|....|.||:|||.|.|.|.||:.|||:           ||::....|..   
 Worm   190 PP-VVSRSTPAAVEVREGNNVSLTCKADGNPTPTVIWRRQ-----------DRQIIRYNGATGFG 242

  Fly   194 --------LTLWQVQRSHMGAYLCIASNGVPPTVSKRVMLVVNFAPTIWTRYDTIYVGLGQKLTL 250
                    |.|.:|.|.||..|||:||||:||..|..|.|:|.|.|.:..:.:|:...:|....:
 Worm   243 ASVFHGPVLHLTKVSRKHMSEYLCVASNGIPPDESWTVKLLVTFPPLVQAQSETVQASVGSMARM 307

  Fly   251 ECITESQPASVNFWLRDSQLLQGGSYES--VSVDHV----FRIVMRITLRPITKRDFGEYICRAK 309
            .|.||:.|.....|.:|.:.:    |||  |::.|.    :..|..:.:|.:....||.|.|.||
 Worm   308 VCTTEAWPRPEMGWEKDGEPV----YESNNVAMTHTVSGQYHSVHILEIRNVQSSHFGVYRCVAK 368

  Fly   310 NAMGQTDRIITVHHKAKKHGQ--HSHQTSS 337
            |..|       :||......|  |:|.|:|
 Worm   369 NDNG-------IHHSQVTLNQISHNHFTNS 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 37/93 (40%)
Ig 39..122 CDD:299845 37/90 (41%)
Ig 132..213 CDD:299845 32/91 (35%)
IG_like 141..227 CDD:214653 36/96 (38%)
IG_like 239..322 CDD:214653 23/88 (26%)
IGc2 245..313 CDD:197706 21/73 (29%)
rig-5NP_001251131.1 IG_like 92..189 CDD:214653 41/99 (41%)
Ig_3 191..270 CDD:372822 31/90 (34%)
IG 294..380 CDD:214652 25/96 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I6913
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 196 1.000 Inparanoid score I2513
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - otm14489
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.