DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and IGSF5

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_011527774.1 Gene:IGSF5 / 150084 HGNCID:5952 Length:497 Species:Homo sapiens


Alignment Length:302 Identity:61/302 - (20%)
Similarity:95/302 - (31%) Gaps:114/302 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FSELN----NSDPKFSGPINNSTVPVGRDALLTCVVHDLVSFKVAWLRVDTQTILSIQ--NHVIT 81
            |.|.|    :.:....|| .|:.|..|..|...|.|..  .:|:....:....:||::  ..:||
Human   118 FLEKNAGSGSGNEVIEGP-QNARVLKGSQARFNCTVSQ--GWKLIMWALSDMVVLSVRPMEPIIT 179

  Fly    82 KNHRISISHTE--HRIWQLKIRDVQESDRGWYMCQINTDPMKSQMGYLDVVVP------------ 132
            .:...|..:.:  :...::.|.:|:.||.|...|.:....:... .||.|.|.            
Human   180 NDRFTSQRYDQGGNFTSEMIIHNVEPSDSGNIRCSLQNSRLHGS-AYLTVQVMGELFIPSVNLVV 243

  Fly   133 ------------------PDI-------------------VDYQTSQDVVRSTGQ-NVTLTCSAT 159
                              |||                   .|.|::..::..|.| |.||||.| 
Human   244 AENEPCEVTCLPSHWTRLPDISWELGLLVSHSSYYFVPEPSDLQSAVSILALTPQSNGTLTCVA- 307

  Fly   160 GVPMPTITWR----REEATPILISDDGDREVFSVEGQNLTLWQVQRSHMGAYLCIASNGVPPTVS 220
                   ||:    |:.||                 .|||:.:..:...|..      .:|..:|
Human   308 -------TWKSLKARKSAT-----------------VNLTVIRCPQDTGGGI------NIPGVLS 342

  Fly   221 KRVMLVVNFAPTIWTRYDTIYVGLGQ----------KLTLEC 252
            ....|  .|:...|.:     ||||.          .||:.|
Human   343 SLPSL--GFSLPTWGK-----VGLGLAGTMLLTPTCTLTIRC 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 18/89 (20%)
Ig 39..122 CDD:299845 18/86 (21%)
Ig 132..213 CDD:299845 22/134 (16%)
IG_like 141..227 CDD:214653 20/90 (22%)
IG_like 239..322 CDD:214653 7/24 (29%)
IGc2 245..313 CDD:197706 4/18 (22%)
IGSF5XP_011527774.1 IG_like 135..228 CDD:214653 21/96 (22%)
Ig <200..230 CDD:299845 9/30 (30%)
Ig 236..307 CDD:299845 12/70 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143425
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.