Sequence 1: | NP_001097100.1 | Gene: | DIP-iota / 33925 | FlyBaseID: | FBgn0031837 | Length: | 376 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001070657.1 | Gene: | Fcgr2b / 14130 | MGIID: | 95499 | Length: | 340 | Species: | Mus musculus |
Alignment Length: | 201 | Identity: | 48/201 - (23%) |
---|---|---|---|
Similarity: | 72/201 - (35%) | Gaps: | 49/201 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 50 LTCVVHDL----VSFKVAWLRV---DTQTILSIQNHVITKNHRISISHTEHRIWQLKIRDVQE-- 105
Fly 106 ----------SDRGWYMCQIN----TDPMKSQMGYLDVVVPPDIVDYQTSQDVVRSTGQNVTLTC 156
Fly 157 SATGVPMPTITWRREEATPILISDDGDREVFSVEGQNLTLWQVQRSHMGAYLCIASNGVPPTVSK 221
Fly 222 RVMLVV 227 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-iota | NP_001097100.1 | IG_like | 39..125 | CDD:214653 | 22/97 (23%) |
Ig | 39..122 | CDD:299845 | 22/94 (23%) | ||
Ig | 132..213 | CDD:299845 | 18/80 (23%) | ||
IG_like | 141..227 | CDD:214653 | 20/85 (24%) | ||
IG_like | 239..322 | CDD:214653 | |||
IGc2 | 245..313 | CDD:197706 | |||
Fcgr2b | NP_001070657.1 | Ig | 46..124 | CDD:299845 | 19/93 (20%) |
IG_like | 52..110 | CDD:214653 | 13/66 (20%) | ||
Ig2_FcgammaR_like | 128..210 | CDD:143230 | 22/91 (24%) | ||
IG_like | 134..210 | CDD:214653 | 20/85 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |