DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and Fcgr1

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_034316.1 Gene:Fcgr1 / 14129 MGIID:95498 Length:404 Species:Mus musculus


Alignment Length:225 Identity:49/225 - (21%)
Similarity:87/225 - (38%) Gaps:55/225 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 IRDVQESDRGWYMCQIN----TDPMKSQMGYLDVVVPPDIVDYQTSQDVVRSTGQNVTLTCSATG 160
            |.:....|.|.|.|||.    :||::.|       :..|.:..|.|:.|: :.|:.:.|.|..  
Mouse    82 IPEASFQDSGEYRCQIGSSMPSDPVQLQ-------I
HNDWLLLQASRRVL-TEGEPLALRCHG-- 136

  Fly   161 VPMPTITWRREEATPILISDDGDREVFSVEGQNLTLWQVQRSHMGAYLC-------IASNGVPPT 218
                   |:.:....::...:|....||.:.: :.:.:...||.|.|.|       ..|.||..|
Mouse   137 -------WKNKLVYNVVFYRNGKSFQFSSDSE-VAILKTNLSHSGIYHCSGTGRHRYTSAGVSIT 193

  Fly   219 VSKRVMLVVNFAPTIWTRYDTIYVGLGQKLTLECITE---SQPA---SVNFWLRDSQLLQGGSYE 277
            | |.:........::.:.:..     |..:||.|.|.   .:|.   ..:|:: .|::|:   |.
Mouse   194 V
-KELFTTPVLRASVSSPFPE-----GSLVTLNCETNLLLQRPGLQLHFSFYV-GSKILE---YR 248

  Fly   278 SVSVD-HVFRIVMRITLRPITKRDFGEYIC 306
            :.|.: |:.|         ..:.|.|.|.|
Mouse   249 NTSSEYHIAR---------AEREDAGFYWC 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 10/28 (36%)
Ig 39..122 CDD:299845 9/25 (36%)
Ig 132..213 CDD:299845 16/87 (18%)
IG_like 141..227 CDD:214653 20/92 (22%)
IG_like 239..322 CDD:214653 17/75 (23%)
IGc2 245..313 CDD:197706 17/69 (25%)
Fcgr1NP_034316.1 Ig1_FcgammaR_like 32..110 CDD:143229 10/34 (29%)
IG_like 38..110 CDD:214653 10/34 (29%)
Ig 114..194 CDD:299845 18/90 (20%)
IG_like 125..194 CDD:214653 15/78 (19%)
ig 205..283 CDD:278476 17/83 (20%)
IG_like 213..271 CDD:214653 17/75 (23%)
Interaction with EPB41L2. /evidence=ECO:0000250 321..342
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 346..404
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.