DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and Opcml

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_017450901.1 Gene:Opcml / 116597 RGDID:620635 Length:354 Species:Rattus norvegicus


Alignment Length:299 Identity:93/299 - (31%)
Similarity:149/299 - (49%) Gaps:19/299 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LNNSDPKFSGPINNSTVPVGRDALLTCVVHDLVSFKVAWLRVDTQTILSIQNHVITKNHRISISH 90
            :.:.|..|...::|.||..|..|.|.|.:.|.|: :||||  :..|||...|...:.:.|:.|..
  Rat    31 VRSGDATFPKAMDNVTVRQGESATLRCTIDDRVT-RVAWL--NRSTILYAGNDKWSIDPRVIILV 92

  Fly    91 TEHRIWQLKIRDVQESDRGWYMCQINTD--PMKSQMGYLDVVVPPDIVDYQTSQDVVRSTGQNVT 153
            .....:.:.|::|...|.|.|.|.:.||  |..|:: :|.|.|||.|::  .|.|:..:.|.:||
  Rat    93 NTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRV-HLIVQVPPQIMN--ISSDITVNEGSSVT 154

  Fly   154 LTCSATGVPMPTITWRREEATPILISDDGDREVFSVEGQNLTLWQVQRSHMGAYLCIASNGVPPT 218
            |.|.|.|.|.||:|||.      |...:|  :.|..|.:.|.:..::|...|.|.|.|.|.|...
  Rat   155 LLCLAIGRPEPTVTWRH------LSVKEG--QGFVSEDEYLEISDIKRDQSGEYECSALNDVAAP 211

  Fly   219 VSKRVMLVVNFAPTIWTRYDTIYVGLGQKLTLECITESQPASVNFWLRDSQLLQGGSYESVSVDH 283
            ..::|.:.||:.|.| ::.....|.:|||..|.|...:.|.:...|.::...|..| .:.|.:::
  Rat   212 DVRKVKITVNYPPYI-SKAKNTGVSVGQKGILSCEASAVPMAEFQWFKEDTRLATG-LDGVRIEN 274

  Fly   284 VFRIVMRITLRPITKRDFGEYICRAKNAMGQTDRIITVH 322
            ..|| ..:|...::::|:|.|.|.|.|.:|.|:..||::
  Rat   275 KGRI-STLTFFNVSEKDYGNYTCVATNKLGNTNASITLY 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 29/87 (33%)
Ig 39..122 CDD:299845 28/84 (33%)
Ig 132..213 CDD:299845 28/80 (35%)
IG_like 141..227 CDD:214653 28/85 (33%)
IG_like 239..322 CDD:214653 24/82 (29%)
IGc2 245..313 CDD:197706 19/67 (28%)
OpcmlXP_017450901.1 Ig 44..132 CDD:416386 30/91 (33%)
Ig strand A' 44..49 CDD:409353 3/4 (75%)
Ig strand B 51..59 CDD:409353 3/7 (43%)
CDR1 59..63 CDD:409353 1/3 (33%)
FR2 64..70 CDD:409353 4/8 (50%)
Ig strand C 64..70 CDD:409353 4/8 (50%)
CDR2 71..83 CDD:409353 4/11 (36%)
Ig strand C' 72..76 CDD:409353 2/3 (67%)
Ig strand C' 80..83 CDD:409353 0/2 (0%)
FR3 84..118 CDD:409353 8/33 (24%)
Ig strand D 87..94 CDD:409353 2/6 (33%)
Ig strand E 97..103 CDD:409353 0/5 (0%)
Ig strand F 110..118 CDD:409353 3/7 (43%)
CDR3 119..123 CDD:409353 2/3 (67%)
Ig strand G 123..132 CDD:409353 3/9 (33%)
FR4 125..132 CDD:409353 2/7 (29%)
Ig_3 135..206 CDD:404760 28/80 (35%)
Ig strand A 135..138 CDD:409353 2/2 (100%)
Ig strand A' 144..148 CDD:409353 1/3 (33%)
Ig strand B 151..160 CDD:409353 4/8 (50%)
Ig strand C 165..170 CDD:409353 3/4 (75%)
Ig strand C' 171..174 CDD:409353 1/8 (13%)
Ig strand F 198..206 CDD:409353 4/7 (57%)
Ig_3 223..300 CDD:404760 21/79 (27%)
putative Ig strand A 224..230 CDD:409353 2/6 (33%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 0/3 (0%)
Ig strand F 293..298 CDD:409353 2/4 (50%)
Ig strand G 306..309 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337198
Domainoid 1 1.000 45 1.000 Domainoid score I11853
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4382
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8971
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X97
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.800

Return to query results.
Submit another query.