DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and LILRB5

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_011524661.1 Gene:LILRB5 / 10990 HGNCID:6609 Length:670 Species:Homo sapiens


Alignment Length:227 Identity:52/227 - (22%)
Similarity:83/227 - (36%) Gaps:53/227 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 RGWYMCQINTDPMKSQMGYLDVVVP-----PDIVDYQTSQDVVRSTGQNVTLTC-SATGVPMPTI 166
            |.:|..:.|.....:....|:::||     |.::..|.|   |.:.|.::||.| |..|..:..:
Human   194 RCYYYYRKNPQVWSNPSDLLEILV
PGVSRKPSLLIPQGS---VVARGGSLTLQCRSDVGYDIFVL 255

  Fly   167 TWRREEATPILISDDGDREVFSVEGQNLTLWQVQRSHMGAYLCIASNGVPPTVSKRVMLVVNFAP 231
               .:|....|:...|.:....:...|.||..|.|||.|.|.|..::.:.|..|         ||
Human   256 ---YKEGEHDLVQGSGQQPQAGLSQANFTLGPVSRSHGGQYRCYGAHNLSPRWS---------AP 308

  Fly   232 TIWTRYDTIYVGL-----------------GQKLTLECITESQPASVNFWLRDS-----QLLQGG 274
            :  ...|.:..||                 |:.:||.|  :|......|:|...     .|....
Human   309 S--DPLDILIAGLIPDIPALSVQPGPKVASGENVTLLC--QSWHQIDTFFLTKEGAAHPPLCLKS 369

  Fly   275 SYESVSVDHVFRIVMRITLRPITKRDFGEYIC 306
            .|:|      :|.....::.|:|....|.|.|
Human   370 KYQS------YRHQAEFSMSPVTSAQGGTYRC 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 3/16 (19%)
Ig 39..122 CDD:299845 3/13 (23%)
Ig 132..213 CDD:299845 24/86 (28%)
IG_like 141..227 CDD:214653 23/86 (27%)
IG_like 239..322 CDD:214653 18/90 (20%)
IGc2 245..313 CDD:197706 16/67 (24%)
LILRB5XP_011524661.1 Ig 27..118 CDD:299845
Ig 124..217 CDD:299845 4/22 (18%)
Ig 223..316 CDD:299845 28/109 (26%)
IG_like 229..>295 CDD:214653 21/71 (30%)
Ig 324..417 CDD:299845 16/80 (20%)
IG_like 334..>395 CDD:214653 15/68 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.