DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and pigrl4.2

DIOPT Version :10

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001293038.1 Gene:pigrl4.2 / 105665605 ZFINID:ZDB-GENE-150409-10 Length:240 Species:Danio rerio


Alignment Length:225 Identity:54/225 - (24%)
Similarity:84/225 - (37%) Gaps:44/225 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLQSVCFSQASFSELNNSDPKFSGPINNSTVPV--GRDALLTCVVHDLVSF-KVAWLRVDTQ--- 70
            ||.:|.|..|....:...|          .|||  |....:.|:..:.... |..|...:|.   
Zfish     6 LLIAVLFCTAGTLSMKTLD----------RVPVIEGETITIPCLYDNKYKLNKKYWCNGNTWLGC 60

  Fly    71 TILSIQNHVITKNHRISISHTEHRIWQLKIRDVQESDRGWYMCQINTDPM--KSQMGYLDVVVPP 133
            ::::..||  |....|: .:.:|.::.:.:.:...||.|.|.|.:..|..  .|:..||.|...|
Zfish    61 SVVAYANH--TGKWTIT-DYPDHNMFTVTLNNSTSSDSGHYWCAVEIDHHVDNSKYLYLTVQKAP 122

  Fly   134 DIVDYQTSQDVVRSTGQNVTLTCSATGV---------PMPTITWRREEAT------PILISDDGD 183
            |:  ...|..|....|.:|::.|.....         .:..:|..||:.|      .:.|||||:
Zfish   123 DV--SVLSSSVSGHKGDDVSVRCFYRSAYQNKLKQWCRIDDLTCFREKKTDTSQNSSVQISDDGE 185

  Fly   184 REVFSVEGQNLTLWQVQRSHMGAYLCIASN 213
            .. |:|....|.|     |..|.|.|...|
Zfish   186 SS-FTVLMTGLRL-----SDSGWYFCSVGN 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 20/93 (22%)
Ig strand B 48..52 CDD:143290 0/3 (0%)
Ig strand C 61..65 CDD:143290 1/3 (33%)
Ig strand E 96..100 CDD:143290 0/3 (0%)
Ig strand F 110..115 CDD:143290 2/4 (50%)
Ig 133..227 CDD:472250 25/96 (26%)
Ig strand B 152..156 CDD:409562 1/3 (33%)
Ig strand C 165..169 CDD:409562 1/3 (33%)
Ig strand E 192..196 CDD:409562 1/3 (33%)
Ig strand F 206..211 CDD:409562 2/4 (50%)
Ig strand G 220..223 CDD:409562
Ig_3 231..310 CDD:464046
pigrl4.2NP_001293038.1 IgV_pIgR_like 30..117 CDD:409381 18/89 (20%)
Ig strand B 32..39 CDD:409381 0/6 (0%)
CDR1 39..47 CDD:409381 0/7 (0%)
Ig strand C 47..52 CDD:409381 1/4 (25%)
FR2 48..52 CDD:409381 1/3 (33%)
CDR2 53..68 CDD:409381 1/14 (7%)
Ig strand C' 61..64 CDD:409381 0/2 (0%)
Ig strand C' 66..68 CDD:409381 0/1 (0%)
FR3 71..102 CDD:409381 7/31 (23%)
Ig strand D 71..77 CDD:409381 1/6 (17%)
Ig strand E 81..89 CDD:409381 0/7 (0%)
Ig strand F 95..102 CDD:409381 3/6 (50%)
CDR3 103..111 CDD:409381 1/7 (14%)
FR4 111..117 CDD:409381 2/5 (40%)
Ig strand G 111..117 CDD:409381 2/5 (40%)
Ig 133..217 CDD:472250 21/83 (25%)
Ig strand B 139..143 CDD:409381 1/3 (33%)
Ig strand C 153..157 CDD:409381 0/3 (0%)
Ig strand E 188..192 CDD:409381 2/3 (67%)
Ig strand F 202..207 CDD:409381 2/4 (50%)
Ig strand G 211..214 CDD:409381
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.