DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and pigrl4.2

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001293038.1 Gene:pigrl4.2 / 105665605 ZFINID:ZDB-GENE-150409-10 Length:240 Species:Danio rerio


Alignment Length:225 Identity:54/225 - (24%)
Similarity:84/225 - (37%) Gaps:44/225 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLQSVCFSQASFSELNNSDPKFSGPINNSTVPV--GRDALLTCVVHDLVSF-KVAWLRVDTQ--- 70
            ||.:|.|..|....:...|          .|||  |....:.|:..:.... |..|...:|.   
Zfish     6 LLIAVLFCTAGTLSMKTLD----------RVPVIEGETITIPCLYDNKYKLNKKYWCNGNTWLGC 60

  Fly    71 TILSIQNHVITKNHRISISHTEHRIWQLKIRDVQESDRGWYMCQINTDPM--KSQMGYLDVVVPP 133
            ::::..||  |....|: .:.:|.::.:.:.:...||.|.|.|.:..|..  .|:..||.|...|
Zfish    61 SVVAYANH--TGKWTIT-DYPDHNMFTVTLNNSTSSDSGHYWCAVEIDHHVDNSKYLYLTVQKAP 122

  Fly   134 DIVDYQTSQDVVRSTGQNVTLTCSATGV---------PMPTITWRREEAT------PILISDDGD 183
            |:  ...|..|....|.:|::.|.....         .:..:|..||:.|      .:.|||||:
Zfish   123 DV--SVLSSSVSGHKGDDVSVRCFYRSAYQNKLKQWCRIDDLTCFREKKTDTSQNSSVQISDDGE 185

  Fly   184 REVFSVEGQNLTLWQVQRSHMGAYLCIASN 213
            .. |:|....|.|     |..|.|.|...|
Zfish   186 SS-FTVLMTGLRL-----SDSGWYFCSVGN 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 20/93 (22%)
Ig 39..122 CDD:299845 19/90 (21%)
Ig 132..213 CDD:299845 24/95 (25%)
IG_like 141..227 CDD:214653 23/88 (26%)
IG_like 239..322 CDD:214653
IGc2 245..313 CDD:197706
pigrl4.2NP_001293038.1 IG_like 26..118 CDD:214653 22/94 (23%)
Ig_pIgR 30..117 CDD:143193 18/89 (20%)
Ig 133..217 CDD:299845 21/83 (25%)
IG_like 136..218 CDD:214653 21/80 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I12510
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.