| Sequence 1: | NP_001097100.1 | Gene: | DIP-iota / 33925 | FlyBaseID: | FBgn0031837 | Length: | 376 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_031761656.1 | Gene: | igsf9b / 100379858 | XenbaseID: | XB-GENE-5887265 | Length: | 1392 | Species: | Xenopus tropicalis |
| Alignment Length: | 345 | Identity: | 77/345 - (22%) |
|---|---|---|---|
| Similarity: | 136/345 - (39%) | Gaps: | 65/345 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 27 NNSDPKFSGPINNSTVPVGRDALLTC-VVHDLV----SFKVAWLRVDTQTILSIQ-----NHVIT 81
Fly 82 KNHRISISHTEHRIWQLKIRDVQESDRGWYMCQI-----NTDPM-KSQMGYLDVVVPPDIVDYQT 140
Fly 141 SQDVVRSTGQNVTLTCSATGVPMPTITWRREEATPILISDDGDREVFSVEGQNLTLWQVQRSHMG 205
Fly 206 AYLCIASNGVPPTVSKRVMLVVNFAPTIWTRYDTIYVGLGQKLTLECITESQPASVN---FWLRD 267
Fly 268 SQLLQGGSYESVSVDHVFRIVMRITLR------PITKRDFGEYICRAKNAMGQT---DRIITVHH 323
Fly 324 KAK----------KHGQHSH 333 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| DIP-iota | NP_001097100.1 | IG_like | 39..125 | CDD:214653 | 22/101 (22%) |
| Ig | 39..122 | CDD:299845 | 22/98 (22%) | ||
| Ig | 132..213 | CDD:299845 | 24/80 (30%) | ||
| IG_like | 141..227 | CDD:214653 | 23/85 (27%) | ||
| IG_like | 239..322 | CDD:214653 | 18/94 (19%) | ||
| IGc2 | 245..313 | CDD:197706 | 14/76 (18%) | ||
| igsf9b | XP_031761656.1 | IG | 30..115 | CDD:214652 | 23/93 (25%) |
| I-set | 139..225 | CDD:400151 | 24/93 (26%) | ||
| Ig strand A | 139..142 | CDD:409353 | 1/2 (50%) | ||
| Ig strand A' | 148..151 | CDD:409353 | 0/2 (0%) | ||
| Ig strand B | 157..164 | CDD:409353 | 4/6 (67%) | ||
| Ig strand C | 170..175 | CDD:409353 | 2/4 (50%) | ||
| Ig strand D | 185..189 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 191..195 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 204..212 | CDD:409353 | 4/7 (57%) | ||
| Ig strand G | 215..225 | CDD:409353 | 1/9 (11%) | ||
| I-set | 229..321 | CDD:400151 | 19/101 (19%) | ||
| Ig strand B | 246..250 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 260..264 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 286..290 | CDD:409353 | 0/3 (0%) | ||
| Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 314..317 | CDD:409353 | 0/2 (0%) | ||
| Ig | 344..405 | CDD:409353 | 77/345 (22%) | ||
| Ig strand C | 355..360 | CDD:409353 | |||
| Ig strand E | 380..384 | CDD:409353 | |||
| Ig strand F | 394..399 | CDD:409353 | |||
| Ig | 429..505 | CDD:416386 | |||
| Ig strand A' | 429..432 | CDD:409353 | |||
| Ig strand B | 438..445 | CDD:409353 | |||
| Ig strand C | 451..456 | CDD:409353 | |||
| Ig strand C' | 458..460 | CDD:409353 | |||
| Ig strand E | 471..476 | CDD:409353 | |||
| Ig strand F | 484..492 | CDD:409353 | |||
| Ig strand G | 495..505 | CDD:409353 | |||
| FN3 | 510..605 | CDD:238020 | |||
| FN3 | 622..703 | CDD:238020 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||