powered by:
Protein Alignment DIP-iota and adgrl1.1
DIOPT Version :9
Sequence 1: | NP_001097100.1 |
Gene: | DIP-iota / 33925 |
FlyBaseID: | FBgn0031837 |
Length: | 376 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002660669.2 |
Gene: | adgrl1.1 / 100334775 |
ZFINID: | ZDB-GENE-130116-2 |
Length: | 390 |
Species: | Danio rerio |
Alignment Length: | 52 |
Identity: | 14/52 - (26%) |
Similarity: | 18/52 - (34%) |
Gaps: | 15/52 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 114 QINTDPMKSQMGYLDVVVPPDIVDYQTSQDVVRSTGQNVTLTCSATGVPMPT 165
|..|||:.:. |....||. |....|::..|.|.||..|
Zfish 330 QPTTDPLSTP---LLSTTPPS------------SLSSTVSMGFSPTSVPSVT 366
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D265311at33208 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.