DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and adgrl1.1

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_002660669.2 Gene:adgrl1.1 / 100334775 ZFINID:ZDB-GENE-130116-2 Length:390 Species:Danio rerio


Alignment Length:52 Identity:14/52 - (26%)
Similarity:18/52 - (34%) Gaps:15/52 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 QINTDPMKSQMGYLDVVVPPDIVDYQTSQDVVRSTGQNVTLTCSATGVPMPT 165
            |..|||:.:.   |....||.            |....|::..|.|.||..|
Zfish   330 QPTTDPLSTP---LLSTTPPS------------SLSSTVSMGFSPTSVPSVT 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 4/10 (40%)
Ig 39..122 CDD:299845 4/7 (57%)
Ig 132..213 CDD:299845 9/34 (26%)
IG_like 141..227 CDD:214653 7/25 (28%)
IG_like 239..322 CDD:214653
IGc2 245..313 CDD:197706
adgrl1.1XP_002660669.2 OLF 72..328 CDD:295358
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.