DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and negr1

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_031755650.1 Gene:negr1 / 100127726 XenbaseID:XB-GENE-987949 Length:388 Species:Xenopus tropicalis


Alignment Length:359 Identity:105/359 - (29%)
Similarity:166/359 - (46%) Gaps:44/359 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WL--LLLQSVCFSQASFSELNNSDPKFSGP-INNSTVPVGRDALLTCVVHDLVSFKVAWLRVDTQ 70
            ||  ::|...|...:......:.|  |..| ::|..|..|..|:|.|.:.:..| |.|||  :..
 Frog    17 WLAAVILSLCCLLPSCLPAGQSMD--FQWPAVDNLVVRQGETAMLRCFLEEGAS-KGAWL--NRS 76

  Fly    71 TILSIQNHVITKNHRISISHTEHRIWQLKIRDVQESDRGWYMCQINTD--PMKSQMGYLDVVVPP 133
            :|:.......:.:.|:||:.:..:.:.|:|:.|..||.|.|.|.:.|:  |...|: :|.|.|.|
 Frog    77 SIIFAGGDKWSVDPRVSIATSSKQEYSLRIQKVDVSDDGPYTCSVQTEHSPRTLQV-HLTVHVSP 140

  Fly   134 DIVDYQTSQDVVRSTGQNVTLTCSATGVPMPTITWRREEATPILISDDGDREVFSVEGQNLTLWQ 198
            .|  |..|.|:..:.|.||:|.|.|||.|.|:|:||.       ||....:  |. .||.|.::.
 Frog   141 KI--YDISSDMTVNEGTNVSLICLATGKPEPSISWRH-------ISPSAKQ--FG-SGQYLDIYG 193

  Fly   199 VQRSHMGAYLCIASNGVPPTVSKRVMLVVNFAPTIWTRYDTIYVGLGQKLTLECITESQPASVNF 263
            :.|...|.|.|.|.|.|.....|:|.:.|||||||.....| .|.||:...:.|.|.:.||.|..
 Frog   194 ITRDQAGDYECSAENDVSFPDVKKVKVTVNFAPTILEITPT-GVSLGRTGLIRCETAAVPAPVFE 257

  Fly   264 WLRDSQLLQGG-------SYESVSVDHVFRIVMRITLRPITKRDFGEYICRAKNAMGQTDRIITV 321
            |.:..:.|..|       :|.:.|:         :|:..:|:..||.|.|.|.|.:|.::..:.:
 Frog   258 WYKGEKKLTNGQRGIRIQNYNTRSI---------LTVSNVTEEHFGNYTCVAVNKLGTSNASLPL 313

  Fly   322 HHKAKKHGQHSHQTSSRESQFIVIEEYIANMSDK 355
            :...:........:|::.|    ::.|..:.|||
 Frog   314 NQIIEPSTTSPVTSSAKYS----VKHYARSSSDK 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 26/87 (30%)
Ig 39..122 CDD:299845 25/84 (30%)
Ig 132..213 CDD:299845 29/80 (36%)
IG_like 141..227 CDD:214653 30/85 (35%)
IG_like 239..322 CDD:214653 23/89 (26%)
IGc2 245..313 CDD:197706 19/74 (26%)
negr1XP_031755650.1 Ig 44..136 CDD:416386 28/95 (29%)
FR1 44..62 CDD:409353 6/17 (35%)
Ig strand A' 47..53 CDD:409353 2/5 (40%)
Ig strand B 55..63 CDD:409353 3/7 (43%)
CDR1 63..68 CDD:409353 0/4 (0%)
FR2 69..75 CDD:409353 4/7 (57%)
Ig strand C 69..74 CDD:409353 4/6 (67%)
CDR2 76..87 CDD:409353 1/10 (10%)
Ig strand C' 78..82 CDD:409353 1/3 (33%)
Ig strand C' 84..87 CDD:409353 0/2 (0%)
FR3 88..122 CDD:409353 11/33 (33%)
Ig strand D 91..98 CDD:409353 3/6 (50%)
Ig strand E 101..107 CDD:409353 1/5 (20%)
Ig strand F 114..122 CDD:409353 3/7 (43%)
CDR3 123..127 CDD:409353 1/3 (33%)
Ig strand G 127..136 CDD:409353 3/9 (33%)
FR4 129..136 CDD:409353 2/7 (29%)
Ig_3 140..208 CDD:404760 29/79 (37%)
Ig strand A' 146..151 CDD:409353 2/4 (50%)
Ig strand B 157..164 CDD:409353 3/6 (50%)
Ig strand C 170..175 CDD:409353 2/4 (50%)
Ig strand C' 177..179 CDD:409353 1/1 (100%)
Ig strand E 187..193 CDD:409353 2/5 (40%)
Ig strand F 200..207 CDD:409353 3/6 (50%)
Ig strand G 214..222 CDD:409353 2/7 (29%)
Ig_3 226..302 CDD:404760 24/85 (28%)
putative Ig strand A 226..232 CDD:409353 3/5 (60%)
Ig strand B 242..246 CDD:409353 0/3 (0%)
Ig strand C 255..259 CDD:409353 1/3 (33%)
Ig strand E 281..285 CDD:409353 1/12 (8%)
Ig strand F 295..300 CDD:409353 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10578
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I4412
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.