DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-iota and lsamp

DIOPT Version :9

Sequence 1:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_031751462.1 Gene:lsamp / 100124984 XenbaseID:XB-GENE-5759171 Length:368 Species:Xenopus tropicalis


Alignment Length:357 Identity:103/357 - (28%)
Similarity:154/357 - (43%) Gaps:61/357 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RLPSFWLLLLQSVCFSQASFSELNNSDPKFSGPIN----NSTVPVGRDALLTCVVHDLVSFKVAW 64
            :||   ||||:.:|.       |....|..||..|    |.||..|..|:|.|.|.|. |.:|||
 Frog    11 QLP---LLLLRLLCL-------LPTGLPVRSGDFNRSTDNITVRQGDTAILRCFVEDR-SSRVAW 64

  Fly    65 LRVDTQTILSIQNHVITKNHRISISHTEHRIWQLKIRDVQESDRGWYMCQINT-DPMKSQMGYLD 128
            |  :...|:...:...:.:.|:.:.......:.|:|:.|..||.|.|.|.:.| ...|:...||.
 Frog    65 L--NRSGIIFAGDDKWSLDPRVELEKRSLLEYSLRIQKVDVSDEGPYTCSVQTKQHTKTTQVYLI 127

  Fly   129 VVVPPDIVDYQTSQDVVRSTGQNVTLTCSATGVPMPTITWRREEATPILISD-----DGDREVFS 188
            |.|||.|.:  .|.|:..:.|.||||.|.|.|.|.|.||||  ..||...:.     :|:.|...
 Frog   128 VQVPPKISN--ISADITVNEGSNVTLMCIAYGRPEPMITWR--HLTPTAGTSPARDFEGEEEFLE 188

  Fly   189 VEGQNLTLWQVQRSHMGAYLCIASNGVPPTVSKRVMLVVNFAPTIWTRYDTIYVGLGQKLTLECI 253
            ::|       :.|...|.|.|.|:|.|.....|:|.:.||:.|.| |...:.....|::..|.|.
 Frog   189 IQG-------ITREQSGRYECKAANEVASADVKQVRVTVNYPPII-TESKSNEATTGKQAILRCE 245

  Fly   254 TESQPASVNFWLRD---------SQLLQGGSYESVSVDHVFRIVMRITLRPITKRDFGEYICRAK 309
            ..:.||....|.:|         :|.|:..:..|.||         :.:..:|:..:|.|.|.|.
 Frog   246 ASAVPAPDFEWYKDDTRSRRINSAQGLEIRNTGSRSV---------LMVANVTEEHYGNYTCVAA 301

  Fly   310 NAMGQTDRIITVHHK--------AKKHGQHSH 333
            |.:|.|:..:.::.:        |.:.|.:.|
 Frog   302 NKLGITNTSLYLYKRVSPTKPMSASERGSNVH 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 26/86 (30%)
Ig 39..122 CDD:299845 25/83 (30%)
Ig 132..213 CDD:299845 29/85 (34%)
IG_like 141..227 CDD:214653 30/90 (33%)
IG_like 239..322 CDD:214653 20/91 (22%)
IGc2 245..313 CDD:197706 18/76 (24%)
lsampXP_031751462.1 Ig 38..128 CDD:416386 28/92 (30%)
FR1 38..54 CDD:409353 6/15 (40%)
Ig strand A' 39..45 CDD:409353 3/5 (60%)
Ig strand B 47..55 CDD:409353 3/7 (43%)
CDR1 55..59 CDD:409353 2/4 (50%)
FR2 60..67 CDD:409353 4/8 (50%)
Ig strand C 60..66 CDD:409353 4/7 (57%)
CDR2 68..78 CDD:409353 1/9 (11%)
Ig strand C' 70..73 CDD:409353 1/2 (50%)
Ig strand C' 75..78 CDD:409353 0/2 (0%)
FR3 79..114 CDD:409353 9/34 (26%)
Ig strand D 83..90 CDD:409353 1/6 (17%)
Ig strand E 93..99 CDD:409353 1/5 (20%)
Ig strand F 106..114 CDD:409353 3/7 (43%)
CDR3 115..119 CDD:409353 1/3 (33%)
Ig strand G 119..128 CDD:409353 3/8 (38%)
FR4 121..128 CDD:409353 2/6 (33%)
Ig_3 131..206 CDD:404760 29/85 (34%)
Ig strand A' 138..143 CDD:409353 2/4 (50%)
Ig strand B 149..156 CDD:409353 4/6 (67%)
Ig strand C 162..167 CDD:409353 4/6 (67%)
Ig strand C' 173..175 CDD:409353 0/1 (0%)
Ig strand E 185..191 CDD:409353 1/5 (20%)
Ig strand F 198..205 CDD:409353 3/6 (50%)
Ig strand G 212..220 CDD:409353 2/7 (29%)
Ig_3 223..302 CDD:404760 20/88 (23%)
putative Ig strand A 224..230 CDD:409353 3/6 (50%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 281..285 CDD:409353 2/12 (17%)
Ig strand F 295..300 CDD:409353 2/4 (50%)
Ig strand G 308..311 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10578
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I4412
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.