DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11050 and YGK1

DIOPT Version :9

Sequence 1:NP_609052.1 Gene:CG11050 / 33924 FlyBaseID:FBgn0031836 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_011414.1 Gene:YGK1 / 852777 SGDID:S000003069 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:182 Identity:68/182 - (37%)
Similarity:107/182 - (58%) Gaps:13/182 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 LQFMELIGNLKHTKRTGWVLRDVNDCESISGHMYRMSMLTFLLDGSEGLNQIRCMELALVHDLAE 245
            |.|:.:|..||..:|||||...::.|||||.|||||.:.|.|:. .:.:::.:|:.:|||||.||
Yeast    30 LAFLNIIQLLKTQRRTGWVDHGIDPCESISDHMYRMGLTTMLIT-DKNVDRNKCIRIALVHDFAE 93

  Fly   246 SLVGDITPFCGISKDDKRAMEFKAMEDICKLI-----EPRGKRIMELFEEYEHGQTAESKFVKDL 305
            ||||||||...::|::|...||:.::.:|:.|     |...:.|::.:..||.....|.::|||:
Yeast    94 SLVGDITPNDPMTKEEKHRREFETVKYLCESIIRPCSESASREILDDWLAYEKQTCLEGRYVKDI 158

  Fly   306 DRLDMVMQAFEYEKRDNCLLKHQEFFDSTEGKFNH---PFVKKLVNEIYEQR 354
            |:.:|::|.||||::.|.....::|.    |..|.   ..|||....:.|.|
Yeast   159 DKYEMLVQCFEYEQKYNGKKDLKQFL----GAINDIKTDEVKKWTQSLLEDR 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11050NP_609052.1 HD_3 187..323 CDD:289769 57/140 (41%)
YGK1NP_011414.1 YfbR 25..210 CDD:224808 68/182 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346677
Domainoid 1 1.000 116 1.000 Domainoid score I1302
eggNOG 1 0.900 - - E1_COG1896
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002944
OrthoInspector 1 1.000 - - otm46654
orthoMCL 1 0.900 - - OOG6_101371
Panther 1 1.100 - - O PTHR11845
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3076
SonicParanoid 1 1.000 - - X1945
TreeFam 1 0.960 - -
1211.730

Return to query results.
Submit another query.