DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11050 and AT1G26160

DIOPT Version :9

Sequence 1:NP_609052.1 Gene:CG11050 / 33924 FlyBaseID:FBgn0031836 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_564240.1 Gene:AT1G26160 / 839157 AraportID:AT1G26160 Length:258 Species:Arabidopsis thaliana


Alignment Length:183 Identity:71/183 - (38%)
Similarity:115/183 - (62%) Gaps:4/183 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 SSGLGEILQFMELIGNLKHTKRTGWVLRDVNDCESISGHMYRMSMLTFLLDGSEGLNQIRCMELA 238
            :|.:...:.|:.|...||.|||.||:.:.:|..|||:.|||||:::..:.....|:::.||:::|
plant    69 ASSVSSSIDFLTLCHRLKTTKRKGWINQGINGPESIADHMYRMALMALIAGDLTGVDRERCIKMA 133

  Fly   239 LVHDLAESLVGDITPFCGISKDDKRAMEFKAMEDICKLIEP--RGKRIMELFEEYEHGQTAESKF 301
            :|||:||::||||||..|:.|::|...|..|::::|:::..  |.:.|.||:.|||:..:.|:..
plant   134 IVHDIAEAIVGDITPSDGVPKEEKSRRETAALKEMCEVLGGGLRAEEITELWLEYENNASLEANI 198

  Fly   302 VKDLDRLDMVMQAFEYEKRDNCLLKHQEFFDSTEGKFNHPFVKKLVNEIYEQR 354
            |||.|:::|::||.|||.....:|  .|||.||.|||.....|....||..:|
plant   199 VKDFDKVEMILQALEYEAEHGKVL--DEFFISTAGKFQTEIGKSWAAEINARR 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11050NP_609052.1 HD_3 187..323 CDD:289769 55/137 (40%)
AT1G26160NP_564240.1 HD_3 84..239 CDD:404045 64/156 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 143 1.000 Domainoid score I1499
eggNOG 1 0.900 - - E1_COG1896
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 165 1.000 Inparanoid score I1586
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002944
OrthoInspector 1 1.000 - - otm2597
orthoMCL 1 0.900 - - OOG6_101371
Panther 1 1.100 - - O PTHR11845
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1945
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.820

Return to query results.
Submit another query.