DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11050 and Hddc2

DIOPT Version :9

Sequence 1:NP_609052.1 Gene:CG11050 / 33924 FlyBaseID:FBgn0031836 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_030101111.1 Gene:Hddc2 / 69692 MGIID:1916942 Length:287 Species:Mus musculus


Alignment Length:286 Identity:101/286 - (35%)
Similarity:149/286 - (52%) Gaps:39/286 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 SSQQQQH-------QQTATKFAMSSLAAEPLQSQKSDEITASTGGG-----------DVETPGLG 154
            ||...||       ...|..|:.||.||   |.::..  :|..|||           .:..||:.
Mouse    11 SSYALQHGFGLVRLWSRAVAFSASSWAA---QGERVG--SAWPGGGAAQLRHRPHATSLAQPGVA 70

  Fly   155 ASCHEVAAASASAGKKPCFSSGLGEILQFMELIGN---------LKHTKRTGWVLRDVNDCESIS 210
            ......|.....|...|..::     .|.|.::.:         |....|||||.|:|...||:|
Mouse    71 GGYAAEAGPGTRARSMPSAAT-----TQAMAMLRSGSGRQEPKPLHRVPRTGWVYRNVEKPESVS 130

  Fly   211 GHMYRMSMLTFLLDGSEGLNQIRCMELALVHDLAESLVGDITPFCGISKDDKRAMEFKAMEDICK 275
            .|||||:::. ::...:.||:.||:.||||||:||.:||||.|...|.|::|...|.:||:.|.:
Mouse   131 DHMYRMAVMA-MVTRDDRLNKDRCIRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKQITQ 194

  Fly   276 LI-EPRGKRIMELFEEYEHGQTAESKFVKDLDRLDMVMQAFEYEKRDNCLLKHQEFFDSTEGKFN 339
            |: |...|.:.||:||||...:.|:||||.||:.:|::||.|||..:|...:.|:|:|||.|||:
Mouse   195 LLPEDLRKELYELWEEYETQSSEEAKFVKQLDQCEMILQASEYEDLENKPGRLQDFYDSTAGKFS 259

  Fly   340 HPFVKKLVNEIYEQRDVLAKAKGATP 365
            ||.:.:||:|:..:|:.......|.|
Mouse   260 HPEIVQLVSELETERNASMATASAEP 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11050NP_609052.1 HD_3 187..323 CDD:289769 62/145 (43%)
Hddc2XP_030101111.1 HD_3 110..263 CDD:372434 73/153 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850492
Domainoid 1 1.000 130 1.000 Domainoid score I5209
eggNOG 1 0.900 - - E1_COG1896
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5431
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002944
OrthoInspector 1 1.000 - - oto92685
orthoMCL 1 0.900 - - OOG6_101371
Panther 1 1.100 - - LDO PTHR11845
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3076
SonicParanoid 1 1.000 - - X1945
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.730

Return to query results.
Submit another query.