DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11050 and hddc2

DIOPT Version :9

Sequence 1:NP_609052.1 Gene:CG11050 / 33924 FlyBaseID:FBgn0031836 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001038696.1 Gene:hddc2 / 554129 ZFINID:ZDB-GENE-050522-394 Length:200 Species:Danio rerio


Alignment Length:179 Identity:86/179 - (48%)
Similarity:117/179 - (65%) Gaps:2/179 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 LGEILQFMELIGNLKHTKRTGWVLRDVNDCESISGHMYRMSMLTFLLDGSEGLNQIRCMELALVH 241
            :..:||||:|:|.||...|||||.|::...||:|.|||||||:...:. ...:|:.|||:|||||
Zfish     1 MDNMLQFMKLVGQLKRVPRTGWVYRNIKQPESVSDHMYRMSMMALTIQ-DISVNKERCMKLALVH 64

  Fly   242 DLAESLVGDITPFCGISKDDKRAMEFKAMEDICKLIEP-RGKRIMELFEEYEHGQTAESKFVKDL 305
            ||||.:||||.|...:||.:|...|..||..|..|::. ..|.|..|:||||...:.|:|.||:|
Zfish    65 DLAECIVGDIAPADNVSKAEKHRREKDAMVHITGLLDDGLRKEIYNLWEEYETQSSPEAKLVKEL 129

  Fly   306 DRLDMVMQAFEYEKRDNCLLKHQEFFDSTEGKFNHPFVKKLVNEIYEQR 354
            |.|:|::||.|||:.:....:.||||.||||||:||.|..|:..:.|:|
Zfish   130 DNLEMIIQAHEYEELEGKPGRLQEFFVSTEGKFHHPEVLGLLKSLNEER 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11050NP_609052.1 HD_3 187..323 CDD:289769 65/136 (48%)
hddc2NP_001038696.1 HD_3 11..164 CDD:289769 75/153 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596445
Domainoid 1 1.000 122 1.000 Domainoid score I5603
eggNOG 1 0.900 - - E1_COG1896
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5431
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002944
OrthoInspector 1 1.000 - - oto38992
orthoMCL 1 0.900 - - OOG6_101371
Panther 1 1.100 - - LDO PTHR11845
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3076
SonicParanoid 1 1.000 - - X1945
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.730

Return to query results.
Submit another query.