DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11050 and HDDC2

DIOPT Version :9

Sequence 1:NP_609052.1 Gene:CG11050 / 33924 FlyBaseID:FBgn0031836 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_057147.2 Gene:HDDC2 / 51020 HGNCID:21078 Length:204 Species:Homo sapiens


Alignment Length:202 Identity:89/202 - (44%)
Similarity:129/202 - (63%) Gaps:2/202 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 ASAGKKPCFSSGLGEILQFMELIGNLKHTKRTGWVLRDVNDCESISGHMYRMSMLTFLLDGSEGL 229
            ||.........|...:|||:.|:|.||...|||||.|:|...||:|.|||||:::..::. .:.|
Human     2 ASVSSATFSGHGARSLLQFLRLVGQLKRVPRTGWVYRNVQRPESVSDHMYRMAVMAMVIK-DDRL 65

  Fly   230 NQIRCMELALVHDLAESLVGDITPFCGISKDDKRAMEFKAMEDICKLI-EPRGKRIMELFEEYEH 293
            |:.||:.||||||:||.:||||.|...|.|::|...|.:||:.|.:|: |...|.:.||:||||.
Human    66 NKDRCVRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKQITQLLPEDLRKELYELWEEYET 130

  Fly   294 GQTAESKFVKDLDRLDMVMQAFEYEKRDNCLLKHQEFFDSTEGKFNHPFVKKLVNEIYEQRDVLA 358
            ..:||:||||.||:.:|::||.|||..::...:.|:|:|||.||||||.:.:||:|:..:|....
Human   131 QSSAEAKFVKQLDQCEMILQASEYEDLEHKPGRLQDFYDSTAGKFNHPEIVQLVSELEAERSTNI 195

  Fly   359 KAKGATP 365
            .|..:.|
Human   196 AAAASEP 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11050NP_609052.1 HD_3 187..323 CDD:289769 65/136 (48%)
HDDC2NP_057147.2 HD_3 24..183 CDD:289769 76/159 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160121
Domainoid 1 1.000 130 1.000 Domainoid score I5225
eggNOG 1 0.900 - - E1_COG1896
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5431
Inparanoid 1 1.050 168 1.000 Inparanoid score I4156
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002944
OrthoInspector 1 1.000 - - oto89118
orthoMCL 1 0.900 - - OOG6_101371
Panther 1 1.100 - - LDO PTHR11845
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3076
SonicParanoid 1 1.000 - - X1945
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.780

Return to query results.
Submit another query.