DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11050 and Hddc2

DIOPT Version :9

Sequence 1:NP_609052.1 Gene:CG11050 / 33924 FlyBaseID:FBgn0031836 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001101930.1 Gene:Hddc2 / 361462 RGDID:1307562 Length:199 Species:Rattus norvegicus


Alignment Length:207 Identity:88/207 - (42%)
Similarity:133/207 - (64%) Gaps:17/207 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 AAASASAGKKPCFSSGLGEILQFMELIGNLKHTKRTGWVLRDVNDCESISGHMYRMSMLTFLLDG 225
            |.::..||           :|:|:.|:|.||...|||||.|:|...||:|.|||||:::. ::..
  Rat     4 ATSNCQAG-----------LLRFLRLVGQLKRVPRTGWVYRNVEKPESVSDHMYRMAVMA-MVTR 56

  Fly   226 SEGLNQIRCMELALVHDLAESLVGDITPFCGISKDDKRAMEFKAMEDICKLI-EPRGKRIMELFE 289
            .:.||:.||:.||||||:||.:||||.|...|.|::|...|.:||::|.:|: |...|.:.||:|
  Rat    57 DDRLNKDRCIRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKEITQLLPEDLRKELYELWE 121

  Fly   290 EYEHGQTAESKFVKDLDRLDMVMQAFEYEKRDNCLLKHQEFFDSTEGKFNHPFVKKLVNEIYEQR 354
            |||...:.|::|||.||:.:|::||.|||..:|...:.|:|:|||.|||:||.:.:||:|:..:|
  Rat   122 EYETQSSEEARFVKQLDQCEMILQASEYEDMENKPGRLQDFYDSTAGKFSHPEIVQLVSELETER 186

  Fly   355 DVLAKAKGATPP 366
            :    |..||.|
  Rat   187 N----ASMATTP 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11050NP_609052.1 HD_3 187..323 CDD:289769 63/136 (46%)
Hddc2NP_001101930.1 HD_3 19..175 CDD:404045 74/156 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354188
Domainoid 1 1.000 130 1.000 Domainoid score I5095
eggNOG 1 0.900 - - E1_COG1896
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5431
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002944
OrthoInspector 1 1.000 - - oto96247
orthoMCL 1 0.900 - - OOG6_101371
Panther 1 1.100 - - LDO PTHR11845
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1945
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.700

Return to query results.
Submit another query.