DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11050 and F45F2.9

DIOPT Version :9

Sequence 1:NP_609052.1 Gene:CG11050 / 33924 FlyBaseID:FBgn0031836 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001256098.1 Gene:F45F2.9 / 185809 WormBaseID:WBGene00018481 Length:187 Species:Caenorhabditis elegans


Alignment Length:166 Identity:70/166 - (42%)
Similarity:106/166 - (63%) Gaps:4/166 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 EILQFMELIGNLKHTKRTGWVLRDVNDCESISGHMYRMSMLTFLLDGS-EGLNQIRCMELALVHD 242
            :|.:.::::.||||.||||||...|.:.|:::.|||||::|...|:|. :||:.||.:::|||||
 Worm     5 KIFELLDVLDNLKHLKRTGWVKCGVPEPETVACHMYRMAVLAMALEGQIDGLDAIRTVKMALVHD 69

  Fly   243 LAESLVGDITPFCGISKDDKRAMEFKAMEDICKLIEPRGKRIMELFEEYEHGQTAESKFVKDLDR 307
            :.|::.|||||.||:|..||..:|.||:..|...:...|:....|::|||...:..::.||.||:
 Worm    70 IGEAIAGDITPHCGVSDQDKFDLEKKAINTIASFVPNVGEEWTMLWKEYEEASSLTARVVKHLDK 134

  Fly   308 LDMVMQAFEYEKRDNCLLKHQEFFDSTEGKFN-HPF 342
            .||::||.:|||.....|  |:||.||.|... .||
 Worm   135 FDMIVQADKYEKTHEIDL--QQFFTSTVGVLKMEPF 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11050NP_609052.1 HD_3 187..323 CDD:289769 60/136 (44%)
F45F2.9NP_001256098.1 HD_3 13..164 CDD:372434 67/152 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167621
Domainoid 1 1.000 124 1.000 Domainoid score I3426
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H5431
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002944
OrthoInspector 1 1.000 - - oto18600
orthoMCL 1 0.900 - - OOG6_101371
Panther 1 1.100 - - LDO PTHR11845
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3076
SonicParanoid 1 1.000 - - X1945
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.