DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11050 and hddc2

DIOPT Version :9

Sequence 1:NP_609052.1 Gene:CG11050 / 33924 FlyBaseID:FBgn0031836 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_002936040.1 Gene:hddc2 / 100379693 XenbaseID:XB-GENE-953491 Length:201 Species:Xenopus tropicalis


Alignment Length:202 Identity:97/202 - (48%)
Similarity:139/202 - (68%) Gaps:7/202 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 ASAGKKPCFSSGLGEILQFMELIGNLKHTKRTGWVLRDVNDCESISGHMYRMSMLTFLLDGSEGL 229
            |:||.  |.|:| ..:||||:|:|.||...||||:.|.|...||:|.|||||:::..|.:..: |
 Frog     2 AAAGS--CSSAG-KSLLQFMKLVGQLKRVPRTGWIYRQVEKPESVSDHMYRMAVMAMLTEDRK-L 62

  Fly   230 NQIRCMELALVHDLAESLVGDITPFCGISKDDKRAMEFKAMEDICKLIEPRGK-RIMELFEEYEH 293
            |:.||:.||||||:||.:||||.|...|||::|...|..||:.:.:|:....| .:..|:|||||
 Frog    63 NKDRCIRLALVHDMAECIVGDIAPADNISKEEKHRKEKDAMQHLTQLLPDILKTEVYNLWEEYEH 127

  Fly   294 GQTAESKFVKDLDRLDMVMQAFEYEKRDNCLLKHQEFFDSTEGKFNHPFVKKLVNEIYEQRD--V 356
            ..|||:||||:||:.:|::||.|||:.:|...:.|:|::||.||||||.|.:||:.|||:||  :
 Frog   128 QSTAEAKFVKELDQCEMILQALEYEELENRPGRLQDFYNSTAGKFNHPEVVQLVSAIYEERDSAI 192

  Fly   357 LAKAKGA 363
            .|.|:.:
 Frog   193 AANARSS 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11050NP_609052.1 HD_3 187..323 CDD:289769 65/136 (48%)
hddc2XP_002936040.1 HD_3 21..174 CDD:372434 73/153 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 134 1.000 Domainoid score I4996
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5431
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002944
OrthoInspector 1 1.000 - - oto102971
Panther 1 1.100 - - LDO PTHR11845
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3076
SonicParanoid 1 1.000 - - X1945
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.040

Return to query results.
Submit another query.