DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11319 and AT5G36210

DIOPT Version :9

Sequence 1:NP_001285682.1 Gene:CG11319 / 33923 FlyBaseID:FBgn0031835 Length:940 Species:Drosophila melanogaster
Sequence 2:NP_198470.3 Gene:AT5G36210 / 833618 AraportID:AT5G36210 Length:730 Species:Arabidopsis thaliana


Alignment Length:517 Identity:97/517 - (18%)
Similarity:177/517 - (34%) Gaps:139/517 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   456 WDQLDNWIYFLG----------------------TPERLPSQQHLYRVSALPARQGQALRSPDCL 498
            ||:.:.|:.::.                      |..:..|:..|:.|:  ..:.|         
plant   267 WDKAELWVGYISEGGNIDKRVCVAGCDPKYVESPTEPKWSSRGELFFVT--DRKNG--------- 320

  Fly   499 TCPAVSQWSEGYDE--------GHTKSPPKLVTAWDDDWEDSEEAEAQPPQPALPVEQQPPGR-- 553
             |..:.:|.|..:|        |....|     .|.......|..|....:..:....:..|:  
plant   321 -CWNIHKWIESTNEVVSVYPLDGEFAKP-----LWIFGTNSYEIIECSEEKNLIACSYRQKGKSY 379

  Fly   554 --------GQSAPLPPPPSD---------CLYHEAKFPISRQAKYVLIDCLGPVVPTSILYGLKS 601
                    |..:.|..|.:|         |||               ::....|:|.|:    ..
plant   380 LGIVDDSQGSCSLLDIPLTDFDSITLGNQCLY---------------VEGASAVLPPSV----AR 425

  Fly   602 AAADSAKTKRHSTQQEEPPTEGGDEKPGEEPKSQFLELLVIVQNNTRLKEKMAKTAMPQIKTFPV 666
            ...|..|||..|::                         ::..::..:.:..|..::|::..||.
plant   426 VTLDQHKTKALSSE-------------------------IVWSSSPDVLKYKAYFSVPELIEFPT 465

  Fly   667 MISGGYHAQVRLYLP--PVLREDEITRYPTILHVYSGPGSQ------LVTDHWHVDWNTYLSGSK 723
            .:. |.:|....|.|  |:.......:.|.::..:.||.::      |...:|         .|:
plant   466 EVP-GQNAYAYFYPPTNPLYNASMEEKPPLLVKSHGGPTAESRGSLNLNIQYW---------TSR 520

  Fly   724 DYIVVEIDGRGSAGQGYQLLHEVYKRLGSVEVSDQLEVSEYLRDNLHFIDSRRMGVWGWSYGGYT 788
            .:..|:::..||.|.|.:....:.::.|.|:|.|....::||..: ...|.:|:.:.|.|.||||
plant   521 GWAFVDVNYGGSTGYGREYRERLLRQWGIVDVDDCCGCAKYLVSS-GKADVKRLCISGGSAGGYT 584

  Fly   789 AALALAGQQSIFQCGISVSPVTNWKLYDS---TYAERYLSFPNVTDNYKGYEESDLSKYVDNLRD 850
            ...:|| .:.:|:.|.|:..|.:.|:...   .:..||:.  |:..:.|.:.|.....:||.. .
plant   585 TLASLA-FRDVFKAGASLYGVADLKMLKEEGHKFESRYID--NLVGDEKDFYERSPINFVDKF-S 645

  Fly   851 RQFLLVHGTADDNVHVQQSMVLARSLTSKGVLYKQQIYPDEGHSL---SGVKRHLYRSMTAF 909
            ...:|..|..|..|...||..:..:|..||:......|..|.|..   ..:|..|.:.|..|
plant   646 CPIILFQGLEDKVVTPDQSRKIYEALKKKGLPVALVEYEGEQHGFRKAENIKYTLEQQMVFF 707

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11319NP_001285682.1 DPPIV_N 123..504 CDD:279298 9/69 (13%)
DAP2 <641..916 CDD:224423 64/283 (23%)
Peptidase_S9 711..916 CDD:278741 51/205 (25%)
AT5G36210NP_198470.3 DAP2 60..714 CDD:224423 97/517 (19%)
Peptidase_S9 509..713 CDD:278741 52/213 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1506
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.