DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ent2 and slc29a4b

DIOPT Version :9

Sequence 1:NP_001285680.1 Gene:Ent2 / 33921 FlyBaseID:FBgn0263916 Length:458 Species:Drosophila melanogaster
Sequence 2:XP_021326781.1 Gene:slc29a4b / 570283 ZFINID:ZDB-GENE-121214-93 Length:521 Species:Danio rerio


Alignment Length:512 Identity:117/512 - (22%)
Similarity:212/512 - (41%) Gaps:106/512 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GKQQAPVTLNPSWESKLPPHDSNGKGSTSVLAKLGLPAPKDKFLIVFFIFLLHGVGTLMPWNMFI 77
            |:::..:| |.|: |:||..:..|:.............|.|::..::|..||.|||.|:|:|.||
Zfish    12 GREKTVIT-NFSF-SQLPEEEKTGRRKPHSAHDSDESIPDDRYHSIYFAMLLAGVGFLLPYNSFI 74

  Fly    78 TAKSYF-EDFKFGPNNTVATEVSYRTHFMQNMGFASQIPNLVFNWLNIFVNFGGDLTTRIVYSII 141
            |...|. ..||   ..::..::|. |:.:..:. |..:.|.:...|:        |.|||....:
Zfish    75 TDVDYLHRKFK---GTSIVFDMSL-TYILVALS-AVIVNNALVERLS--------LHTRICVGYL 126

  Fly   142 FEMVILLVTIILAMLDSSQWPGVF-----FWTTMVCIVLLNVCNGIYQNTIYGIVASLPIKYTGA 201
            |.:..|:...:..:     |..:|     :..|:..:.::.....:.|::.||....||.:||..
Zfish   127 FALGPLVCVSVFDV-----WLELFNTQQSYAVTLAAVAIVAFGCTVQQSSFYGYTGMLPKRYTQG 186

  Fly   202 VVLGSNISGCFTTAMALICGEIFSSKRTSAIYYFVTAILVLLLCFDTYFALPLNKFFRHYETISR 266
            |:.|.:.:|...:...:....:...::.:.|.:|:.::.:..|||..:..:....|.|::.:.:|
Zfish   187 VMTGESTAGVIVSLSRIFTKLLVEDEKNNTIIFFLFSVSMETLCFLLHVVVRRTHFVRYHTSRAR 251

  Fly   267 SS-------------EKKS------DSKAQ------------------------------LNVP- 281
            .|             :|.|      ||.|:                              .:|| 
Zfish   252 QSHSWLKGQINNVTTQKHSGYQIHYDSSAEEEDGMASSMVDDADAVNLGNGSHGDGIYVRFDVPK 316

  Fly   282 -----YWQIFKKAA-----------PQLFNIFLTFFVTLSVFPAIQSNVHRSDPNFVVGPDYFTL 330
                 .|...|:..           |.:.:|.:|:|:||.:||.::|.:|    |..:| ::..:
Zfish   317 PEAKRSWISVKELLGRRCAVARVIWPYMLSILVTYFITLCLFPGLESELH----NDTLG-EWLPI 376

  Fly   331 VTCFATFNVFAMLGSLTTSW-VQWPGPRFLWVPVVLRLAFIPLFVMCNYVPPDSVRSLAVFIEND 394
            :| .|.||:...:|.:..:. .:|.|.:.| |...||:.|:||||||  |.|.....||   ...
Zfish   377 LT-MALFNMADFVGKILAACPYEWGGVQLL-VCSCLRVLFLPLFVMC--VSPVQRPLLA---HPA 434

  Fly   395 WVYWGIGIAMAYSSGYLSSLGMMYAPQTVHTKYQTTAGMYAAAMLITGIFSGVLFSY 451
            |. .|:.:.:..|:|||.|:.|:.|...|..:.:..||.......:.|:..|...||
Zfish   435 WP-CGLSVMLGISNGYLGSVPMIQAAGKVPLQQREVAGNTMTVSYMAGLMLGSAVSY 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ent2NP_001285680.1 Nucleoside_tran 62..457 CDD:301621 106/463 (23%)
slc29a4bXP_021326781.1 Nucleoside_tran 60..490 CDD:326577 104/460 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53699
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.