DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ent2 and slc29a1

DIOPT Version :9

Sequence 1:NP_001285680.1 Gene:Ent2 / 33921 FlyBaseID:FBgn0263916 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001015718.1 Gene:slc29a1 / 548435 XenbaseID:XB-GENE-6454898 Length:455 Species:Xenopus tropicalis


Alignment Length:456 Identity:141/456 - (30%)
Similarity:214/456 - (46%) Gaps:66/456 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PKDKFLIVFFIFLLHGVGTLMPWNMFITAKSYFEDFKFGP----NNTVATEVS------------ 99
            |.|::..|:.||.:.|:|||:|||.|:||..||......|    .|:|.|..|            
 Frog     5 PTDRYNAVWLIFFILGLGTLLPWNFFMTATMYFTSRLAEPGVPRENSVLTPPSVTEPPNSPNDSS 69

  Fly   100 --------YRTH----FMQNMGFASQIPNLVFNWLNIFVNFGGDLTTRIVYSIIFEMVILLVTII 152
                    ::|:    |...|...:.:|.|:|..||.|::.......||..:::...:|.|:|.|
 Frog    70 TRADDMGGHQTYLQSKFNNVMTLCAMLPLLIFTCLNSFLHQRISQNIRIGGTLLAIFLIFLLTAI 134

  Fly   153 LAMLDSSQWPGVFFWTTMVCIVLLNVCNGIYQNTIYGIVASLPIKYTGAVVLGSNISGCFTTAMA 217
            ...:..|  |..||..||:.||.:|....|.|.:::|:.|..|..||..::.|..::|.| .|::
 Frog   135 FVKVPFS--PVSFFTVTMIKIVFINSFGAILQGSLFGLAALFPANYTSPIMSGQGLAGAF-AALS 196

  Fly   218 LICG-EIFSSKRTSAIYYFVTAILVLLLCFDTYFALPLNKFFRHY--ETISRSSEKKSDSKAQL- 278
            :||. ...|:...||..||:||.:|:||...:|.||...:|:|:|  |.:|.::..:.:.|..| 
 Frog   197 MICALASGSALEDSAFGYFITACVVILLALLSYVALNKLEFYRYYTIENVSAAAPAEIELKKDLL 261

  Fly   279 ----------------NVPYWQIFKKAAPQLFNIFLTFFVTLSVFPAIQSNVHRSDPNFVVGPD- 326
                            .....||.||......::.|.|.||:.:|||:.::|..:    :.|.. 
 Frog   262 ENGGGVAETGAESGDGGKSVIQILKKVWVLALSVCLVFGVTIGIFPAVTADVKST----IAGESK 322

  Fly   327 ---YFTLVTCFATFNVFAMLGSLTTSWVQWPG--PRFLWVPVVLRLAFIPLFVMCNYVPPDSVRS 386
               ||..|:||..||:|...|...|....|||  .:.|.:.|..||.|:|||::||..|    |:
 Frog   323 WGIYFIPVSCFLLFNLFDWAGRSLTVLTMWPGQDSKLLPLLVAARLVFLPLFMLCNVSP----RT 383

  Fly   387 -LAVFIENDWVYWGIGIAMAYSSGYLSSLGMMYAPQTVHTKYQTTAGMYAAAMLITGIFSGVLFS 450
             |.|.:.:|..|..|.|..|.|:|||:||.|.:.|:.|......|||...|..|..|:..|...|
 Frog   384 YLPVLLAHDAWYICIMILFAVSNGYLASLCMCFGPKKVGVHEAETAGAIMAFFLSLGLALGAGLS 448

  Fly   451 Y 451
            :
 Frog   449 F 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ent2NP_001285680.1 Nucleoside_tran 62..457 CDD:301621 137/445 (31%)
slc29a1NP_001015718.1 2a57 16..455 CDD:273352 137/445 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11291
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D318009at33208
OrthoFinder 1 1.000 - - FOG0000541
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X296
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.