DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ent2 and SLC29A2

DIOPT Version :9

Sequence 1:NP_001285680.1 Gene:Ent2 / 33921 FlyBaseID:FBgn0263916 Length:458 Species:Drosophila melanogaster
Sequence 2:XP_011543276.1 Gene:SLC29A2 / 3177 HGNCID:11004 Length:472 Species:Homo sapiens


Alignment Length:296 Identity:83/296 - (28%)
Similarity:143/296 - (48%) Gaps:30/296 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 APKDKFLIVFFIFLLHGVGTLMPWNMFITAKSYFEDFKFGPNNTVATEVSYR-------THFMQN 107
            ||:|.:.:|...|.:.|:|||:|||.||||..||:....|..|:.|..:|..       .:|...
Human     6 APRDSYHLVGISFFILGLGTLLPWNFFITAIPYFQARLAGAGNSTARILSTNHTGPEDAFNFNNW 70

  Fly   108 MGFASQIPNLVFNWLNIFVNFGGDLTTRIVYSIIFEMVILLVTIILAMLDSSQWPGVFFWTTMVC 172
            :...||:|.|:|..||.|:......|.||:.|::..:::..:|..|..:|.|  ||.||..||..
Human    71 VTLLSQLPLLLFTLLNSFLYQCVPETVRILGSLLAILLLFALTAALVKVDMS--PGPFFSITMAS 133

  Fly   173 IVLLNVCNGIYQNTIYGIVASLPIKYTGAVVLGSNISGCFTTAMALICGEIFSSKRTSAIYYFVT 237
            :..:|..:.:.|.:::|.:.::|..|:...:.|..::|.|.....|:.........|||:.||:|
Human   134 VCFINSFSAVLQGSLFGQLGTMPSTYSTLFLSGQGLAGIFAALAMLLSMASGVDAETSALGYFIT 198

  Fly   238 AILVLLLCFDTYFALPLNKFFRHY--ETISRSSEKKSDSKAQL------NVPYWQIFKKAAPQLF 294
            ..:.:|:....|.:||..||.|:|  ...|::..::.::||:|      .:|       ::||  
Human   199 PCVGILMSIVCYLSLPHLKFARYYLANKSSQAQAQELETKAELLQSDENGIP-------SSPQ-- 254

  Fly   295 NIFLTFFVTLSVFPAIQSNVHRSDPNFVVGPDYFTL 330
            .:.||..:.|...|..:.:    :|.....|..||:
Human   255 KVALTLDLDLEKEPESEPD----EPQKPGKPSVFTV 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ent2NP_001285680.1 Nucleoside_tran 62..457 CDD:301621 79/284 (28%)
SLC29A2XP_011543276.1 Nucleoside_tran 18..>292 CDD:301621 79/284 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147104
Domainoid 1 1.000 66 1.000 Domainoid score I9927
eggNOG 1 0.900 - - E1_KOG1479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53699
OrthoDB 1 1.010 - - D318009at33208
OrthoFinder 1 1.000 - - FOG0000541
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2123
SonicParanoid 1 1.000 - - X296
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.750

Return to query results.
Submit another query.