DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ent2 and SLC29A4

DIOPT Version :9

Sequence 1:NP_001285680.1 Gene:Ent2 / 33921 FlyBaseID:FBgn0263916 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001035751.1 Gene:SLC29A4 / 222962 HGNCID:23097 Length:530 Species:Homo sapiens


Alignment Length:480 Identity:109/480 - (22%)
Similarity:188/480 - (39%) Gaps:114/480 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 PAPKDKFLIVFFIFLLHGVGTLMPWNMFITAKSYFEDFKFGPNNTVATEVSYRTHFMQNMGFASQ 113
            |.|.|::..::|..||.|||.|:|:|.|||...|.. .|: |..::..::|. |:.:..:. |..
Human    61 PVPDDRYHAIYFAMLLAGVGFLLPYNSFITDVDYLH-HKY-PGTSIVFDMSL-TYILVALA-AVL 121

  Fly   114 IPNLVFNWLNIFVNFGGDLTTRIVYSIIFEMVILLVTIILAMLDSSQWPGVFFWTTMVCIVLLNV 178
            :.|::...|.        |.|||....:..:..||...|..:     |..:|.......|.|..|
Human   122 LNNVLVERLT--------LHTRITAGYLLALGPLLFISICDV-----WLQLFSRDQAYAINLAAV 173

  Fly   179 ------CNGIYQNTIYGIVASLPIKYTGAVVLGSNISGCFTTAMALICGEIFSSKRTSAIYYFVT 237
                  |. :.|::.||....||.:||..|:.|.:.:|...:...::...:...:|.|.:.:|:.
Human   174 GTVAFGCT-VQQSSFYGYTGMLPKRYTQGVMTGESTAGVMISLSRILTKLLLPDERASTLIFFLV 237

  Fly   238 AILVLLLCFDTYFALPLNKFFRHYETISRSS---------------------------------- 268
            ::.:.||||..:..:..::|...|.|..|.|                                  
Human   238 SVALELLCFLLHLLVRRSRFVLFYTTRPRDSHRGRPGLGRGYGYRVHHDVVAGDVHFEHPAPALA 302

  Fly   269 --EKKSDSKA-----------QLNVP------YWQIFKKAA-----------PQLFNIFLTFFVT 303
              |...||.|           :.:||      .|..|:...           ..:.:|.:|:|:|
Human   303 PNESPKDSPAHEVTGSGGAYMRFDVPRPRVQRSWPTFRALLLHRYVVARVIWADMLSIAVTYFIT 367

  Fly   304 LSVFPAIQSNVHRSDPNFVVGPDYFTLVTCFATFNVFAMLGSLTTSW-VQWPGPRFLWVPVVLRL 367
            |.:||.::|.:.    :.::|.  :..:...|.||:...:|.:..:. |.|.|...| ....||:
Human   368 LCLFPGLESEIR----HCILGE--WLPILIMAVFNLSDFVGKILAALPVDWRGTHLL-ACSCLRV 425

  Fly   368 AFIPLFVMCNYVPPDSVRSL------AVFIENDWVYWGIGIAMAYSSGYLSSLGMMYAPQTVHTK 426
            .|||||::|.|  |..:.:|      .:|          .:.|..|:||..|:.|:.|...|..|
Human   426 VFIPLFILCVY--PSGMPALRHPAWPCIF----------SLLMGISNGYFGSVPMILAAGKVSPK 478

  Fly   427 YQTTAGMYAAAMLITGIFSGVLFSY 451
            .:..||.......::|:..|...:|
Human   479 QRELAGNTMTVSYMSGLTLGSAVAY 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ent2NP_001285680.1 Nucleoside_tran 62..457 CDD:301621 105/467 (22%)
SLC29A4NP_001035751.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Nucleoside_tran 75..503 CDD:301621 104/464 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53699
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.