DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ent2 and SLC29A1

DIOPT Version :9

Sequence 1:NP_001285680.1 Gene:Ent2 / 33921 FlyBaseID:FBgn0263916 Length:458 Species:Drosophila melanogaster
Sequence 2:XP_011512643.1 Gene:SLC29A1 / 2030 HGNCID:11003 Length:536 Species:Homo sapiens


Alignment Length:501 Identity:149/501 - (29%)
Similarity:235/501 - (46%) Gaps:63/501 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EAKSEKSPFIGKQQAPVTLNPSWESKLPPHDSNGKGST-SVLAKLGLPAPKDKFLIVFFIFLLHG 66
            :|::|:|     .|......|....:.|...|...|.| :.:.......|:|::..|:.||.:.|
Human    43 QAETEES-----WQGLARKTPGKACQAPEGGSCQPGKTENTITMTTSHQPQDRYKAVWLIFFMLG 102

  Fly    67 VGTLMPWNMFITAKSYFED-FKFGPN-NTVATEVSYRTH------------------FMQNMGFA 111
            :|||:|||.|:||..||.: .....| :.|..|:|....                  |...|...
Human   103 LGTLLPWNFFMTATQYFTNRLDMSQNVSLVTAELSKDAQASAAPAAPLPERNSLSAIFNNVMTLC 167

  Fly   112 SQIPNLVFNWLNIFVNFGGDLTTRIVYSIIFEMVILLVTIILAMLDSSQWPGVFFWTTMVCIVLL 176
            :.:|.|:|.:||.|::.....:.||:.|::..:::.|:|.||..:.....|  ||..||:.|||:
Human   168 AMLPLLLFTYLNSFLHQRIPQSVRILGSLVAILLVFLITAILVKVQLDALP--FFVITMIKIVLI 230

  Fly   177 NVCNGIYQNTIYGIVASLPIKYTGAVVLGSNISGCFTTAMALICGEIFSSKRT-SAIYYFVTAIL 240
            |....|.|.:::|:...||..||..::.|..::| |..::|:||.....|:.: ||..||:||..
Human   231 NSFGAILQGSLFGLAGLLPASYTAPIMSGQGLAG-FFASVAMICAIASGSELSESAFGYFITACA 294

  Fly   241 VLLLCFDTYFALPLNKFFRHYETISRSSEKKSDSKAQL----------------NVPYWQ----- 284
            |::|....|..||..:|:|:|:.:......:.::|..|                :|...|     
Human   295 VIILTIICYLGLPRLEFYRYYQQLKLEGPGEQETKLDLISKGEEPRAGKEESGVSVSNSQPTNES 359

  Fly   285 -----IFKKAAPQLFNIFLTFFVTLSVFPAIQSNVHRSDPNFVVGPDYFTLVTCFATFNVFAMLG 344
                 |.|..:...|::...|.:|:.:|||:...|..|.........||..|:||.|||:|..||
Human   360 HSIKAILKNISVLAFSVCFIFTITIGMFPAVTVEVKSSIAGSSTWERYFIPVSCFLTFNIFDWLG 424

  Fly   345 SLTTSWVQWPGPRFLWVP--VVLRLAFIPLFVMCNYVPPDSVRSLAVFIEND-WVYWGIGIAMAY 406
            ...|:...|||....|:|  |:.||.|:||.::||..|.   |.|.|..|:| |..:.:. |.|:
Human   425 RSLTAVFMWPGKDSRWLPSLVLARLVFVPLLLLCNIKPR---RYLTVVFEHDAWFIFFMA-AFAF 485

  Fly   407 SSGYLSSLGMMYAPQTVHTKYQTTAGMYAAAMLITGIFSGVLFSYL 452
            |:|||:||.|.:.|:.|......|||...|..|..|:..|.:||:|
Human   486 SNGYLASLCMCFGPKKVKPAEAETAGAIMAFFLCLGLALGAVFSFL 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ent2NP_001285680.1 Nucleoside_tran 62..457 CDD:301621 136/441 (31%)
SLC29A1XP_011512643.1 2a57 98..536 CDD:273352 136/441 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147102
Domainoid 1 1.000 66 1.000 Domainoid score I9927
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3732
OMA 1 1.010 - - QHG53699
OrthoDB 1 1.010 - - D318009at33208
OrthoFinder 1 1.000 - - FOG0000541
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2123
SonicParanoid 1 1.000 - - X296
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.700

Return to query results.
Submit another query.